Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN CDK7
 
Authors :  G. Lolli, E. D. Lowe, N. R. Brown, L. N. Johnson
Date :  11 Aug 04  (Deposition) - 07 Dec 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.02
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Cell Cycle; Phosphorylation; Protein-Protein Interaction; Protein Kinase, Cell Cycle, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Lolli, E. D. Lowe, N. R. Brown, L. N. Johnson
The Crystal Structure Of Human Cdk7 And Its Protein Recognition Properties
Structure V. 12 2067 2004
PubMed-ID: 15530371  |  Reference-DOI: 10.1016/J.STR.2004.08.013

(-) Compounds

Molecule 1 - CELL DIVISION PROTEIN KINASE 7
    ChainsA, B, C, D
    EC Number2.7.1.37
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF21
    Expression System CommonFALL ARMYWORM
    Expression System PlasmidPVL1392
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    GeneCDK7
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsSF21 CELLS IN CULTURE
    SynonymCDK-ACTIVATING KINASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1ATP4Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2TPO4Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1ATP1Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1ATP1Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 3 (2, 2)
No.NameCountTypeFull Name
1ATP1Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 4 (2, 2)
No.NameCountTypeFull Name
1ATP1Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:18 , GLU A:20 , GLY A:21 , GLN A:22 , PHE A:23 , ALA A:24 , VAL A:26 , ALA A:39 , LYS A:41 , ASP A:92 , PHE A:93 , MET A:94 , LYS A:139 , ASN A:142 , SER A:161BINDING SITE FOR RESIDUE ATP A 381
2AC2SOFTWARELEU B:18 , GLU B:20 , GLY B:21 , GLN B:22 , PHE B:23 , ALA B:24 , VAL B:26 , ALA B:39 , LYS B:41 , PHE B:91 , ASP B:92 , PHE B:93 , MET B:94 , ASN B:142 , SER B:161BINDING SITE FOR RESIDUE ATP B 382
3AC3SOFTWAREGLU C:20 , GLY C:21 , GLN C:22 , PHE C:23 , ALA C:24 , VAL C:26 , LYS C:41 , ILE C:75 , ASP C:92 , MET C:94 , ASN C:142 , SER C:161BINDING SITE FOR RESIDUE ATP C 383
4AC4SOFTWARELEU D:18 , GLU D:20 , GLY D:21 , GLN D:22 , PHE D:23 , VAL D:26 , ALA D:39 , LYS D:41 , ILE D:75 , ASP D:92 , PHE D:93 , MET D:94 , ASN D:141 , ASN D:142BINDING SITE FOR RESIDUE ATP D 384

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UA2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UA2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 8)

Asymmetric Unit (2, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_023118G163ACDK7_HUMANPolymorphism  ---A/B/C/DG163A
2UniProtVAR_023119T285MCDK7_HUMANPolymorphism34584424A/B/C/DT285M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_023118G163ACDK7_HUMANPolymorphism  ---AG163A
2UniProtVAR_023119T285MCDK7_HUMANPolymorphism34584424AT285M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_023118G163ACDK7_HUMANPolymorphism  ---BG163A
2UniProtVAR_023119T285MCDK7_HUMANPolymorphism34584424BT285M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_023118G163ACDK7_HUMANPolymorphism  ---CG163A
2UniProtVAR_023119T285MCDK7_HUMANPolymorphism34584424CT285M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_023118G163ACDK7_HUMANPolymorphism  ---DG163A
2UniProtVAR_023119T285MCDK7_HUMANPolymorphism34584424DT285M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 8)

Asymmetric Unit (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK7_HUMAN18-42
 
 
 
  4A:18-42
B:18-42
C:18-42
D:18-42
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK7_HUMAN133-145
 
 
 
  4A:133-145
B:133-145
C:133-145
D:133-145
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK7_HUMAN18-42
 
 
 
  1A:18-42
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK7_HUMAN133-145
 
 
 
  1A:133-145
-
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK7_HUMAN18-42
 
 
 
  1-
B:18-42
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK7_HUMAN133-145
 
 
 
  1-
B:133-145
-
-
Biological Unit 3 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK7_HUMAN18-42
 
 
 
  1-
-
C:18-42
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK7_HUMAN133-145
 
 
 
  1-
-
C:133-145
-
Biological Unit 4 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CDK7_HUMAN18-42
 
 
 
  1-
-
-
D:18-42
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CDK7_HUMAN133-145
 
 
 
  1-
-
-
D:133-145

(-) Exons   (11, 44)

Asymmetric Unit (11, 44)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000002564431cENSE00000912295chr5:68530700-68530868169CDK7_HUMAN1-22224A:13-22
B:13-22
C:13-22
D:13-22
10
10
10
10
1.2cENST000002564432cENSE00001202470chr5:68531221-6853128060CDK7_HUMAN23-42204A:23-42
B:23-42
C:23-42
D:23-42
20
20
20
20
1.4ENST000002564434ENSE00001008524chr5:68548245-6854827834CDK7_HUMAN43-54124A:43-43
B:43-43
C:43-43
D:43-43
1
1
1
1
1.5bENST000002564435bENSE00001008526chr5:68550429-6855049668CDK7_HUMAN54-76234A:56-76
B:56-76
C:56-76
D:56-76
21
21
21
21
1.6aENST000002564436aENSE00001008514chr5:68551287-6855135569CDK7_HUMAN77-99234A:77-99
B:77-99
C:77-99
D:77-99
23
23
23
23
1.7ENST000002564437ENSE00001008525chr5:68553870-68553980111CDK7_HUMAN100-136374A:100-136
B:100-136
C:100-136
D:100-136
37
37
37
37
1.8bENST000002564438bENSE00001008523chr5:68555645-68555763119CDK7_HUMAN137-176404A:137-176
B:137-176
C:137-176
D:137-176
40
40
40
40
1.9cENST000002564439cENSE00001008521chr5:68558032-68558131100CDK7_HUMAN176-209344A:176-209
B:176-209
C:176-209
D:176-209
34
34
34
34
1.10ENST0000025644310ENSE00001008518chr5:68565034-6856512087CDK7_HUMAN210-238294A:210-238
B:210-238
C:210-238
D:210-238
29
29
29
29
1.11dENST0000025644311dENSE00001008515chr5:68568719-68568868150CDK7_HUMAN239-288504A:239-288
B:239-288
C:239-288
D:239-288
50
50
50
50
1.12bENST0000025644312bENSE00001008516chr5:68572370-68572517148CDK7_HUMAN289-338504A:289-311
B:289-311
C:289-311
D:289-311
23
23
23
23
1.13cENST0000025644313cENSE00001008520chr5:68572934-68573250317CDK7_HUMAN338-34690--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:287
 aligned with CDK7_HUMAN | P50613 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:299
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
           CDK7_HUMAN    13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
               SCOP domains d1ua2a_ A: Cell division protei            n kinase 7, CDK7                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1ua2A01 A:13-95 Phosphorylase K            inase; domain 1                         1ua2A02 A:96-311 Transferase(Phosphotransferase) domain 1                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeee......eeeeee.------------.hhhhhhhhhhhhh.......eeeee......eeeee...eehhhhhh........hhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee..hhhhh...................hhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.........................hhhhhh...hhhhhhhhhhhhh.......hhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------A-------------------------------------------------------------------------------------------------------------------------M-------------------------- SAPs(SNPs)
                    PROSITE -----PROTEIN_KINASE_ATP       ------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1c Exon 1.2c           Exon 1.4    ----------------------Exon 1.6a  PDB: A:77-99Exon 1.7  PDB: A:100-136             Exon 1.8b  PDB: A:137-176               ---------------------------------Exon 1.10  PDB: A:210-238    Exon 1.11d  PDB: A:239-288 UniProt: 239-288       Exon 1.12b [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.5b  PDB: A:56-76---------------------------------------------------------------------------------------------------Exon 1.9c  PDB: A:176-209         ------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1ua2 A  13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKI------------NRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYtHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
                                    22        32        42|        -   |    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
                                                         43           56                                                                                                               170-TPO                                                                                                                                         

Chain B from PDB  Type:PROTEIN  Length:287
 aligned with CDK7_HUMAN | P50613 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:299
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
           CDK7_HUMAN    13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
               SCOP domains d1ua2b_ B: Cell division protei            n kinase 7, CDK7                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1ua2B01 B:13-95 Phosphorylase K            inase; domain 1                         1ua2B02 B:96-311 Transferase(Phosphotransferase) domain 1                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeee..........eeeee.------------.hhhhhhhhhhhhh.......eeee.......eeeee...eehhhhhh........hhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee..........................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh........hhhhh............hhhhhh...hhhhhhhhhhhh........hhhhhhhhhhhh......hhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------A-------------------------------------------------------------------------------------------------------------------------M-------------------------- SAPs(SNPs)
                    PROSITE -----PROTEIN_KINASE_ATP       ------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1c Exon 1.2c           Exon 1.4    ----------------------Exon 1.6a  PDB: B:77-99Exon 1.7  PDB: B:100-136             Exon 1.8b  PDB: B:137-176               ---------------------------------Exon 1.10  PDB: B:210-238    Exon 1.11d  PDB: B:239-288 UniProt: 239-288       Exon 1.12b [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.5b  PDB: B:56-76---------------------------------------------------------------------------------------------------Exon 1.9c  PDB: B:176-209         ------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1ua2 B  13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKI------------NRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYtHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
                                    22        32        42|        -   |    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
                                                         43           56                                                                                                               170-TPO                                                                                                                                         

Chain C from PDB  Type:PROTEIN  Length:287
 aligned with CDK7_HUMAN | P50613 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:299
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
           CDK7_HUMAN    13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
               SCOP domains d1ua2c_ C: Cell division protei            n kinase 7, CDK7                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1ua2C01 C:13-95 Phosphorylase K            inase; domain 1                         1ua2C02 C:96-311 Transferase(Phosphotransferase) domain 1                                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeee........eeeee.------------.hhhhhhhhhhhhh.......eeeeee....eeeeee...eehhhhhh........hhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee..........................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh.........hhhhh............hhhhhh...hhhhhhhhhhhh........hhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------A-------------------------------------------------------------------------------------------------------------------------M-------------------------- SAPs(SNPs)
                    PROSITE -----PROTEIN_KINASE_ATP       ------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1c Exon 1.2c           Exon 1.4    ----------------------Exon 1.6a  PDB: C:77-99Exon 1.7  PDB: C:100-136             Exon 1.8b  PDB: C:137-176               ---------------------------------Exon 1.10  PDB: C:210-238    Exon 1.11d  PDB: C:239-288 UniProt: 239-288       Exon 1.12b [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.5b  PDB: C:56-76---------------------------------------------------------------------------------------------------Exon 1.9c  PDB: C:176-209         ------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1ua2 C  13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKI------------NRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYtHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
                                    22        32        42|        -   |    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
                                                         43           56                                                                                                               170-TPO                                                                                                                                         

Chain D from PDB  Type:PROTEIN  Length:287
 aligned with CDK7_HUMAN | P50613 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:299
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
           CDK7_HUMAN    13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
               SCOP domains d1ua2d_ D: Cell division protei            n kinase 7, CDK7                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1ua2D01 D:13-95 Phosphorylase K            inase; domain 1                         1ua2D02 D:96-311 Transferase(Phosphotransferase) domain 1                                                                                                                                                                CATH domains
           Pfam domains (1) Pkinase-1ua2D01 D:13-295                                                                                                                                                                                                                                                                   ---------------- Pfam domains (1)
           Pfam domains (2) Pkinase-1ua2D02 D:13-295                                                                                                                                                                                                                                                                   ---------------- Pfam domains (2)
           Pfam domains (3) Pkinase-1ua2D03 D:13-295                                                                                                                                                                                                                                                                   ---------------- Pfam domains (3)
           Pfam domains (4) Pkinase-1ua2D04 D:13-295                                                                                                                                                                                                                                                                   ---------------- Pfam domains (4)
         Sec.struct. author ......eee..eeeeeee......eeeeee.------------.hhhhhhhhhhhhh.......eeeee......eeeee...eehhhhhh.........hhhhhhhhhhhhhhhhhhh...........eee.....eee..........................hhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh........hhhhh............hhhhhh...hhhhhhhhhhhhh.......hhhhhhhhhhhhh.....hhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------A-------------------------------------------------------------------------------------------------------------------------M-------------------------- SAPs(SNPs)
                    PROSITE -----PROTEIN_KINASE_ATP       ------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1c Exon 1.2c           Exon 1.4    ----------------------Exon 1.6a  PDB: D:77-99Exon 1.7  PDB: D:100-136             Exon 1.8b  PDB: D:137-176               ---------------------------------Exon 1.10  PDB: D:210-238    Exon 1.11d  PDB: D:239-288 UniProt: 239-288       Exon 1.12b [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.5b  PDB: D:56-76---------------------------------------------------------------------------------------------------Exon 1.9c  PDB: D:176-209         ------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1ua2 D  13 EKLDFLGEGQFATVYKARDKNTNQIVAIKKI------------NRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYtHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN 311
                                    22        32        42|        -   |    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302         
                                                         43           56                                                                                                               170-TPO                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: PKinase (934)

(-) Gene Ontology  (45, 45)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (CDK7_HUMAN | P50613)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0008094    DNA-dependent ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of single- or double-stranded DNA, and it drives another reaction.
    GO:0008353    RNA polymerase II carboxy-terminal domain kinase activity    Catalysis of the reaction: ATP + (DNA-directed RNA polymerase II) = ADP + phospho-(DNA-directed RNA polymerase II); phosphorylation occurs on residues in the carboxy-terminal domain (CTD) repeats.
    GO:0050681    androgen receptor binding    Interacting selectively and non-covalently with an androgen receptor.
    GO:0004693    cyclin-dependent protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate. This reaction requires the binding of a regulatory cyclin subunit and full activity requires stimulatory phosphorylation by a CDK-activating kinase (CAK).
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0003713    transcription coactivator activity    Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006370    7-methylguanosine mRNA capping    Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0000082    G1/S transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0030521    androgen receptor signaling pathway    Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0006294    nucleotide-excision repair, preincision complex assembly    The aggregation, arrangement and bonding together of proteins on DNA to form the multiprotein complex involved in damage recognition, DNA helix unwinding, and endonucleolytic cleavage at the site of DNA damage. This assembly occurs before the phosphodiester backbone of the damaged strand is cleaved 3' and 5' of the site of DNA damage.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0000079    regulation of cyclin-dependent protein serine/threonine kinase activity    Any process that modulates the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0042795    snRNA transcription from RNA polymerase II promoter    The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
    GO:0006363    termination of RNA polymerase I transcription    The process in which the synthesis of an RNA molecule by RNA polymerase I using a DNA template is completed. RNAP I termination requires binding of a terminator protein so specific sequences downstream of the transcription unit.
    GO:0006362    transcription elongation from RNA polymerase I promoter    The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase I specific promoter by the addition of ribonucleotides catalyzed by RNA polymerase I.
    GO:0006368    transcription elongation from RNA polymerase II promoter    The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006361    transcription initiation from RNA polymerase I promoter    Any process involved in the assembly of the RNA polymerase I preinitiation complex (PIC) at an RNA polymerase I promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
    GO:0006367    transcription initiation from RNA polymerase II promoter    Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005675    holo TFIIH complex    A complex that is capable of kinase activity directed towards the C-terminal Domain (CTD) of the largest subunit of RNA polymerase II and is essential for initiation at RNA polymerase II promoters in vitro. It is composed of the core TFIIH complex and the TFIIK complex.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TPO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ua2)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ua2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CDK7_HUMAN | P50613
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.37
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CDK7_HUMAN | P50613
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CDK7_HUMAN | P506131lg3 1pa8 2hic

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UA2)