|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 12)| Asymmetric/Biological Unit (3, 12) |
Sites (12, 12)
Asymmetric Unit (12, 12)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1THQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1THQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1THQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1THQ) |
Exons (0, 0)| (no "Exon" information available for 1THQ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:147 aligned with PAGP_ECOLI | P37001 from UniProtKB/Swiss-Prot Length:186 Alignment length:157 186 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 | PAGP_ECOLI 32 TTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQF-- - SCOP domains d1thqa_ A: Outer membrane enzym e PagP SCOP domains CATH domains 1thqA00 A:7-163 [code=2.40.160 .20, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1thq A 7 TTFRENIAQTWQQPEHYDLYIPAITWHARFA----------ERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFLE 163 16 26 36| - | 56 66 76 86 96 106 116 126 136 146 156 37 48
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1THQ) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PAGP_ECOLI | P37001)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|