Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF C-TERMINAL DOMAIN OF NIFU-LIKE PROTEIN FROM ORYZA SATIVA
 
Authors :  H. Kumeta, K. Ogura, M. Asayama, S. Katoh, E. Katoh, F. Inagaki
Date :  01 Jun 04  (Deposition) - 27 Sep 05  (Release) - 09 Jun 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Iron-Sulfur Cluster Binding, Structural Genomics, Program For Rice Genome Research, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Kumeta, K. Ogura, M. Asayama, S. Katoh, E. Katoh, K. Teshima, F. Inagaki
The Nmr Structure Of The Domain Ii Of A Chloroplastic Nifu-Like Protein Osnifu1A.
J. Biomol. Nmr V. 38 161 2007
PubMed-ID: 17431550  |  Reference-DOI: 10.1007/S10858-007-9155-9
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NIFU1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPDEST32A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentRESIDUES 154-226
    Organism CommonRICE
    Organism ScientificORYZA SATIVA
    Organism Taxid4530

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TH5)

(-) Sites  (0, 0)

(no "Site" information available for 1TH5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TH5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TH5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TH5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TH5)

(-) Exons   (0, 0)

(no "Exon" information available for 1TH5)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:74
 aligned with NIFU1_ORYSJ | Q84LK7 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:74
                                   162       172       182       192       202       212       222    
          NIFU1_ORYSJ   153 GLELNEENVEKVLNEIRPYLAGTGGGGLQFLMIKGPIVKVRLTGPAAVVRTVRIAVSKKLREKIPSIQIVQLLS 226
               SCOP domains -d1th5a1 A:154-226 NifU-like protein 1, NIFUL1                             SCOP domains
               CATH domains -------------------------------------------------------------------------- CATH domains
               Pfam domains --------NifU-1th5A01 A:161-224                                          -- Pfam domains
         Sec.struct. author ....hhhhhhhhhh.hhhhhh..........eee..eeee..........hhhhhhhhhhhhhh....eeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                 1th5 A 153 MLELNEENVEKVLNEIRPYLAGTGGGGLQFLMIKGPIVKVRLTGPAAVVRTVRIAVSKKLREKIPSIQIVQLLS 226
                                   162       172       182       192       202       212       222    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1TH5)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: NifU (7)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (NIFU1_ORYSJ | Q84LK7)
molecular function
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
biological process
    GO:0016226    iron-sulfur cluster assembly    The incorporation of iron and exogenous sulfur into a metallo-sulfur cluster.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009570    chloroplast stroma    The space enclosed by the double membrane of a chloroplast but excluding the thylakoid space. It contains DNA, ribosomes and some temporary products of photosynthesis.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1th5)
 
  Sites
(no "Sites" information available for 1th5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1th5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1th5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NIFU1_ORYSJ | Q84LK7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NIFU1_ORYSJ | Q84LK7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NIFU1_ORYSJ | Q84LK72jnv

(-) Related Entries Specified in the PDB File

1q48 A STRUCTURAL HOMOLOG