![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
(no "Site" information available for 1TBX) |
(no "SS Bond" information available for 1TBX) |
(no "Cis Peptide Bond" information available for 1TBX) |
(no "SAP(SNP)/Variant" information available for 1TBX) |
(no "PROSITE Motif" information available for 1TBX) |
(no "Exon" information available for 1TBX) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:94 aligned with F93_SSV1 | P20222 from UniProtKB/Swiss-Prot Length:93 Alignment length:94 93 12 22 32 42 52 62 72 82 92| F93_SSV1 3 STPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISLKTAIETYKQIKKR--- - SCOP domains d1tbxa_ A: Hypothetical protein F93 SCOP domains CATH domains 1tbxA00 A:3-96 'winged helix' repressor DNA binding domain CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 1tbx A 3 STPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPmSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISLKTAIETYKQIKKRHHH 96 12 22 32 | 42 52 62 72 82 92 38-MSE Chain B from PDB Type:PROTEIN Length:90 aligned with F93_SSV1 | P20222 from UniProtKB/Swiss-Prot Length:93 Alignment length:90 11 21 31 41 51 61 71 81 91 F93_SSV1 2 KSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISLKTAIETYKQIK 91 SCOP domains d1tbxb_ B: Hypothetical protein F93 SCOP domains CATH domains 1tbxB00 B:2-91 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1tbx B 2 KSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPmSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISLKTAIETYKQIK 91 11 21 31 | 41 51 61 71 81 91 38-MSE
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1TBX) |
Asymmetric Unit(hide GO term definitions) Chain A,B (F93_SSV1 | P20222)
|
|
|
|
|
|
|