Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF INSECT DERIVED DOUBLE DOMAIN KAZAL INHIBITOR RHODNIIN IN COMPLEX WITH THROMBIN
 
Authors :  A. Van De Locht, D. Lamba, W. Bode
Date :  02 Mar 95  (Deposition) - 14 Oct 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym. Unit :  H,J,K,L,R,S
Biol. Unit 1:  H,L,R  (1x)
Biol. Unit 2:  J,K,S  (1x)
Keywords :  Complex (Serine Protease/Inhibitor), Kazal-Type Inhibitor, Thrombin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Van De Locht, D. Lamba, M. Bauer, R. Huber, T. Friedrich, B. Kroger, W. Hoffken, W. Bode
Two Heads Are Better Than One: Crystal Structure Of The Insect Derived Double Domain Kazal Inhibitor Rhodniin In Complex With Thrombin.
Embo J. V. 14 5149 1995
PubMed-ID: 7489704
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THROMBIN
    ChainsL, J
    EC Number3.4.21.5
    OrganPLASMA
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
 
Molecule 2 - THROMBIN
    ChainsH, K
    EC Number3.4.21.5
    OrganPLASMA
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
 
Molecule 3 - RHODNIIN
    ChainsR, S
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GenePRPTI
    Expression System PlasmidPR2C
    Expression System Taxid562
    GenePRPTI
    OrganPLASMA
    Organism ScientificRHODNIUS PROLIXUS
    Organism Taxid13249

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit HJKLRS
Biological Unit 1 (1x)H  LR 
Biological Unit 2 (1x) JK  S

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TBQ)

(-) Sites  (0, 0)

(no "Site" information available for 1TBQ)

(-) SS Bonds  (20, 20)

Asymmetric Unit
No.Residues
1H:42 -H:58
2H:168 -H:182
3H:191 -H:220
4J:1 -K:122
5K:42 -K:58
6K:168 -K:182
7K:191 -K:220
8L:1 -H:122
9R:6 -R:31
10R:8 -R:27
11R:16 -R:48
12R:57 -R:84
13R:60 -R:80
14R:69 -R:101
15S:6 -S:31
16S:8 -S:27
17S:16 -S:48
18S:57 -S:84
19S:60 -S:80
20S:69 -S:101

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Ser H:37 -Pro H:37A
2Ser K:37 -Pro K:37A

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_THRB_BOVIN_001 *D600NTHRB_BOVIN  ---  ---H/KD222N
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_THRB_BOVIN_001 *D600NTHRB_BOVIN  ---  ---HD222N
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_THRB_BOVIN_001 *D600NTHRB_BOVIN  ---  ---KD222N
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (5, 12)

Asymmetric Unit (5, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1KAZAL_2PS51465 Kazal domain profile.THBI_RHOPR1-50
 
51-103
 
  4R:1-50
S:1-50
R:51-103
S:51-103
2KAZAL_1PS00282 Kazal serine protease inhibitors family signature.THBI_RHOPR8-31
 
  2R:8-31
S:8-31
3TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.THRB_BOVIN367-621
 
  2H:16-243
K:16-243
4TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.THRB_BOVIN405-410
 
  2H:53-58
K:53-58
5TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.THRB_BOVIN565-576
 
  2H:189-200
K:189-200
Biological Unit 1 (5, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1KAZAL_2PS51465 Kazal domain profile.THBI_RHOPR1-50
 
51-103
 
  2R:1-50
-
R:51-103
-
2KAZAL_1PS00282 Kazal serine protease inhibitors family signature.THBI_RHOPR8-31
 
  1R:8-31
-
3TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.THRB_BOVIN367-621
 
  1H:16-243
-
4TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.THRB_BOVIN405-410
 
  1H:53-58
-
5TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.THRB_BOVIN565-576
 
  1H:189-200
-
Biological Unit 2 (5, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1KAZAL_2PS51465 Kazal domain profile.THBI_RHOPR1-50
 
51-103
 
  2-
S:1-50
-
S:51-103
2KAZAL_1PS00282 Kazal serine protease inhibitors family signature.THBI_RHOPR8-31
 
  1-
S:8-31
3TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.THRB_BOVIN367-621
 
  1-
K:16-243
4TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.THRB_BOVIN405-410
 
  1-
K:53-58
5TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.THRB_BOVIN565-576
 
  1-
K:189-200

(-) Exons   (7, 16)

Asymmetric Unit (7, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000094061ENSBTAE00000076598chr15:77004894-77005007114THRB_BOVIN1-27270--
1.2ENSBTAT000000094062ENSBTAE00000076606chr15:77005352-77005515164THRB_BOVIN27-81550--
1.3ENSBTAT000000094063ENSBTAE00000306249chr15:77006130-7700615425THRB_BOVIN82-9090--
1.4ENSBTAT000000094064ENSBTAE00000076608chr15:77006384-7700643451THRB_BOVIN90-107180--
1.5ENSBTAT000000094065ENSBTAE00000076609chr15:77007812-77007917106THRB_BOVIN107-142360--
1.6ENSBTAT000000094066ENSBTAE00000076610chr15:77008015-77008151137THRB_BOVIN142-188470--
1.7ENSBTAT000000094067ENSBTAE00000076611chr15:77009362-77009676315THRB_BOVIN188-2931060--
1.8ENSBTAT000000094068ENSBTAE00000076614chr15:77009972-77010106135THRB_BOVIN293-338462-
J:1U-1A
-
L:1U-1A
-
21
-
21
1.9ENSBTAT000000094069ENSBTAE00000076615chr15:77010182-77010308127THRB_BOVIN338-380434H:16-29
J:1A-15
K:16-29
L:1A-15
14
29
14
29
1.10ENSBTAT0000000940610ENSBTAE00000076616chr15:77011290-77011457168THRB_BOVIN380-436572H:29-75
-
K:29-75
-
57
-
57
-
1.11ENSBTAT0000000940611ENSBTAE00000076617chr15:77011956-77012129174THRB_BOVIN436-494592H:75-129B
-
K:75-129B
-
59
-
59
-
1.12ENSBTAT0000000940612ENSBTAE00000306240chr15:77012378-77012559182THRB_BOVIN494-555622H:129B-184A
-
K:129B-184A
-
62
-
62
-
1.13ENSBTAT0000000940613ENSBTAE00000076620chr15:77018853-7701892371THRB_BOVIN555-578242H:184A-202
-
K:184A-202
-
24
-
24
-
1.14ENSBTAT0000000940614ENSBTAE00000076621chr15:77019058-77019320263THRB_BOVIN579-625472H:203-247 (gaps)
-
K:203-247 (gaps)
-
48
-
48
-

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain H from PDB  Type:PROTEIN  Length:259
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:259
                                   376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616         
          THRB_BOVIN    367 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS  625
               SCOP domains d1tbq.1 L:,H: Thrombin                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1tbqH01     1tbqH02 H:28-120,H:233-247 Trypsin-like serine proteases                                                 1tbqH01 H:16-27,H:121-232 Trypsin-like serine proteases                                                                        1tbqH02         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee.....eeeeee.....eeee.hhh...hhh.....hhheeeee.............eee.eeeeee..............eeeee.................hhhhhhh.....eeeeee....................eeeeee...hhhhhhh........eeee...................eeeee......eeeeeeeeeee........eeeeehhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: H:16-243 UniProt: 367-621                                                                                                                                                                                                                    ---- PROSITE (1)
                PROSITE (2) --------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------------- PROSITE (2)
           Transcript 1 (1) -------------Exon 1.10  PDB: H:29-75 UniProt: 380-436                 ---------------------------------------------------------Exon 1.12  PDB: H:129B-184A UniProt: 494-555                  -----------------------Exon 1.14  PDB: H:203-247 (gaps)                Transcript 1 (1)
           Transcript 1 (2) Exon 1.9      -------------------------------------------------------Exon 1.11  PDB: H:75-129B UniProt: 436-494                 ------------------------------------------------------------Exon 1.13               ----------------------------------------------- Transcript 1 (2)
                1tbq H   16 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS  247
                                    25        35  |     44        54      |60D|||||   65        75  |     84        94   |   103       113       123      |130       140      149A||||   155       165       175       184  |||| 190       200    || 208       219 |     228       238         
                                                37A                     60A||||||||               77A                  97A                             129A||                 149A||||                               184A   ||||               204A|          217| |                           
                                                                         60B|||||||                                                                     129B|                  149B|||                                   186A|||                204B           219 |                           
                                                                          60C||||||                                                                      129C                   149C||                                    186B||                                221A                           
                                                                           60D|||||                                                                                              149D|                                     186C|                                                               
                                                                            60E||||                                                                                               149E                                      186D                                                               
                                                                             60F|||                                                                                                                                                                                                            
                                                                              60G||                                                                                                                                                                                                            
                                                                               60H|                                                                                                                                                                                                            
                                                                                60I                                                                                                                                                                                                            

Chain J from PDB  Type:PROTEIN  Length:49
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:49
                                   327       337       347       357         
          THRB_BOVIN    318 TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR  366
               SCOP domains d1tbq.2 J:,K: Thrombin                            SCOP domains
               CATH domains 1tbqJ00 J:1U-15 Epsilon-Thrombin, subunit L       CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhh...hhh.......hhh......hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.8  PDB: J:1U-1---------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.9  PDB: J:1A-15        Transcript 1 (2)
                1tbq J   1U TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR   15
                            ||||||||1L||||||||1B|        9     ||14E|||||||| 
                           1U|||||||1L|||||||1C||            14A||||||14J||| 
                            1T|||||||1K|||||||1B|             14B||||||14K|| 
                             1S|||||| 1J|||||| 1A              14C||||||14L| 
                              1R|||||  1I|||||                  14D||||| 14M 
                               1Q||||   1H||||                   14E||||     
                                1P|||    1G|||                    14F|||     
                                 1O||     1F||                     14G||     
                                  1N|      1E|                      14H|     
                                   1M       1D                       14I     

Chain K from PDB  Type:PROTEIN  Length:259
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:259
                                   376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616         
          THRB_BOVIN    367 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS  625
               SCOP domains d1tbq.2 J:,K: Thrombin                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1tbqK01     1tbqK02 K:28-120,K:233-247 Trypsin-like serine proteases                                                 1tbqK01 K:16-27,K:121-232 Trypsin-like serine proteases                                                                        1tbqK02         CATH domains
           Pfam domains (1) Trypsin-1tbqK01 K:16-238                                                                                                                                                                                                                                  --------- Pfam domains (1)
           Pfam domains (2) Trypsin-1tbqK02 K:16-238                                                                                                                                                                                                                                  --------- Pfam domains (2)
         Sec.struct. author ..............eeeeee.....eeeeee.....eeee.hhh...hhh........eeeee.............eee.eeeeee..............eeeee.................hhhhhhh.....eeeeee....................eeeeee...hhhhhhh........eeee...................eeeee......eeeeeeeeeee........eeeee..hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: K:16-243 UniProt: 367-621                                                                                                                                                                                                                    ---- PROSITE (1)
                PROSITE (2) --------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------------- PROSITE (2)
           Transcript 1 (1) -------------Exon 1.10  PDB: K:29-75 UniProt: 380-436                 ---------------------------------------------------------Exon 1.12  PDB: K:129B-184A UniProt: 494-555                  -----------------------Exon 1.14  PDB: K:203-247 (gaps)                Transcript 1 (1)
           Transcript 1 (2) Exon 1.9      -------------------------------------------------------Exon 1.11  PDB: K:75-129B UniProt: 436-494                 ------------------------------------------------------------Exon 1.13               ----------------------------------------------- Transcript 1 (2)
                1tbq K   16 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS  247
                                    25        35  |     44        54      |60D|||||   65        75  |     84        94   |   103       113       123      |130       140      149A||||   155       165       175       184  |||| 190       200    || 208       219 |     228       238         
                                                37A                     60A||||||||               77A                  97A                             129A||                 149A||||                               184A   ||||               204A|          217| |                           
                                                                         60B|||||||                                                                     129B|                  149B|||                                   186A|||                204B           219 |                           
                                                                          60C||||||                                                                      129C                   149C||                                    186B||                                221A                           
                                                                           60D|||||                                                                                              149D|                                     186C|                                                               
                                                                            60E||||                                                                                               149E                                      186D                                                               
                                                                             60F|||                                                                                                                                                                                                            
                                                                              60G||                                                                                                                                                                                                            
                                                                               60H|                                                                                                                                                                                                            
                                                                                60I                                                                                                                                                                                                            

Chain L from PDB  Type:PROTEIN  Length:49
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:49
                                   327       337       347       357         
          THRB_BOVIN    318 TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR  366
               SCOP domains d1tbq.1 L:,H: Thrombin                            SCOP domains
               CATH domains 1tbqL00 L:1U-15 Epsilon-Thrombin, subunit L       CATH domains
           Pfam domains (1) Thrombin_light-1tbqL01 L:1U-15                    Pfam domains (1)
           Pfam domains (2) Thrombin_light-1tbqL02 L:1U-15                    Pfam domains (2)
         Sec.struct. author ...........hhhh...hhh.......hhh......hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.8  PDB: L:1U-1---------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.9  PDB: L:1A-15        Transcript 1 (2)
                1tbq L   1U TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR   15
                            ||||||||1L||||||||1B|        9     ||14E|||||||| 
                           1U|||||||1L|||||||1C||            14A||||||14J||| 
                            1T|||||||1K|||||||1B|             14B||||||14K|| 
                             1S|||||| 1J|||||| 1A              14C||||||14L| 
                              1R|||||  1I|||||                  14D||||| 14M 
                               1Q||||   1H||||                   14E||||     
                                1P|||    1G|||                    14F|||     
                                 1O||     1F||                     14G||     
                                  1N|      1E|                      14H|     
                                   1M       1D                       14I     

Chain R from PDB  Type:PROTEIN  Length:103
 aligned with THBI_RHOPR | Q06684 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
          THBI_RHOPR      1 EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT  103
               SCOP domains d1tbqr1 R:1-51                                     d1tbqr2 R:52-103                                     SCOP domains
               CATH domains 1tbqR01 R:1-51  [code=3.30.60.30, no name defined] 1tbqR02 R:52-103  [code=3.30.60.30, no name defined] CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee.....eee........hhhhhhhhhh......eeee..........hhhh........eee........hhhhhhhhh.......eeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) KAZAL_2  PDB: R:1-50 UniProt: 1-50                KAZAL_2  PDB: R:51-103 UniProt: 51-103                PROSITE (1)
                PROSITE (2) -------KAZAL_1  PDB: R:8-31    ------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                1tbq R    1 EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT  103
                                    10        20        30        40        50        60        70        80        90       100   

Chain S from PDB  Type:PROTEIN  Length:103
 aligned with THBI_RHOPR | Q06684 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
          THBI_RHOPR      1 EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT  103
               SCOP domains d1tbqs1 S:1-51                                     d1tbqs2 S:52-103                                     SCOP domains
               CATH domains 1tbqS01 S:1-51  [code=3.30.60.30, no name defined] 1tbqS02 S:52-103  [code=3.30.60.30, no name defined] CATH domains
           Pfam domains (1) -----------------------------------------------------------Kazal_2-1tbqS01 S:60-101                  -- Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------Kazal_2-1tbqS02 S:60-101                  -- Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------Kazal_2-1tbqS03 S:60-101                  -- Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------Kazal_2-1tbqS04 S:60-101                  -- Pfam domains (4)
         Sec.struct. author ...hhheee.....eee...eee..hhhhhhhhh.......eeee..........hhhhh.......eee...eee..hhhhhhhhh.......eeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) KAZAL_2  PDB: S:1-50 UniProt: 1-50                KAZAL_2  PDB: S:51-103 UniProt: 51-103                PROSITE (1)
                PROSITE (2) -------KAZAL_1  PDB: S:8-31    ------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                1tbq S    1 EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT  103
                                    10        20        30        40        50        60        70        80        90       100   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit

(-) CATH Domains  (3, 10)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)
3a1tbqH02H:28-120,H:233-247
3b1tbqK02K:28-120,K:233-247
3c1tbqH01H:16-27,H:121-232
3d1tbqK01K:16-27,K:121-232

(-) Pfam Domains  (3, 8)

Asymmetric Unit
(-)
Clan: Kazal (46)

(-) Gene Ontology  (41, 44)

Asymmetric Unit(hide GO term definitions)
Chain H,J,K,L   (THRB_BOVIN | P00735)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0070051    fibrinogen binding    Interacting selectively and non-covalently with fibrinogen, a highly soluble hexameric glycoprotein complex that is found in blood plasma and is converted to fibrin by thrombin in the coagulation cascade.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0070053    thrombospondin receptor activity    Combining with thrombospondin and transmitting the signal to initiate a change in cell activity.
biological process
    GO:0006953    acute-phase response    An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0048712    negative regulation of astrocyte differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of astrocyte differentiation.
    GO:0045861    negative regulation of proteolysis    Any process that stops, prevents, or reduces the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0030194    positive regulation of blood coagulation    Any process that activates or increases the frequency, rate or extent of blood coagulation.
    GO:0030307    positive regulation of cell growth    Any process that activates or increases the frequency, rate, extent or direction of cell growth.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0032967    positive regulation of collagen biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:1900738    positive regulation of phospholipase C-activating G-protein coupled receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of phospholipase C-activating G-protein coupled receptor signaling pathway.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:2000379    positive regulation of reactive oxygen species metabolic process    Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
    GO:0051281    positive regulation of release of sequestered calcium ion into cytosol    Any process that activates or increases the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
    GO:0051480    regulation of cytosolic calcium ion concentration    Any process involved in the maintenance of an internal steady state of calcium ions within the cytosol of a cell or between the cytosol and its surroundings.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain R,S   (THBI_RHOPR | Q06684)
molecular function
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tbq)
 
  Sites
(no "Sites" information available for 1tbq)
 
  Cis Peptide Bonds
    Ser H:37 - Pro H:37A  [ RasMol ]  
    Ser K:37 - Pro K:37A  [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tbq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  THBI_RHOPR | Q06684
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  THRB_BOVIN | P00735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.5
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  THBI_RHOPR | Q06684
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  THRB_BOVIN | P00735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        THBI_RHOPR | Q066841tbr
        THRB_BOVIN | P007351a0h 1avg 1bbr 1etr 1ets 1ett 1hrt 1id5 1mkw 1mkx 1nl1 1nl2 1tbr 1toc 1ucy 1uvt 1uvu 1vit 1ycp 2a1d 2hpp 2ody 2pf1 2pf2 2spt 3pma 3pmb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TBQ)