Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF B. ANTHRACIS PROTECTIVE ANTIGEN COMPLEXED WITH HUMAN ANTHRAX TOXIN RECEPTOR
 
Authors :  E. Santelli, L. A. Bankston, S. H. Leppla, R. C. Liddington
Date :  05 May 04  (Deposition) - 20 Jul 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  X,Y
Keywords :  Bacillus Anthracis; Anthrax Toxin; X-Ray Crystallography, Membrane Protein-Toxin Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Santelli, L. A. Bankston, S. H. Leppla, R. C. Liddington
Crystal Structure Of A Complex Between Anthrax Toxin And It Host Cell Receptor
Nature V. 430 905 2004
PubMed-ID: 15243628  |  Reference-DOI: 10.1038/NATURE02763

(-) Compounds

Molecule 1 - PROTECTIVE ANTIGEN
    ChainsX
    EngineeredYES
    Expression SystemBACILLUS ANTHRACIS
    Expression System StrainBH445
    Expression System Taxid1392
    Expression System Vector TypePLASMID
    Organism ScientificBACILLUS ANTHRACIS
    Organism Taxid1392
 
Molecule 2 - ANTHRAX TOXIN RECEPTOR 2
    ChainsY
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentA/I DOMAIN
    GeneANTXR2,CMG2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCAPILLARY MORPHOGENESIS PROTEIN-2;
CMG-2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit XY

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 6)

Asymmetric/Biological Unit (4, 6)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION
2MN1Ligand/IonMANGANESE (II) ION
3NA2Ligand/IonSODIUM ION
4PG41Ligand/IonTETRAETHYLENE GLYCOL

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP X:177 , ASP X:179 , ASP X:181 , ILE X:183 , GLU X:188BINDING SITE FOR RESIDUE CA X 800
2AC2SOFTWAREASP X:179 , ASP X:181 , GLU X:188 , SER X:222 , LYS X:225 , ASP X:235BINDING SITE FOR RESIDUE CA X 801
3AC3SOFTWAREASP X:683 , SER Y:52 , SER Y:54 , THR Y:118 , HOH Y:401 , HOH Y:402BINDING SITE FOR RESIDUE MN Y 303
4AC4SOFTWAREHIS X:263 , VAL X:264 , SER X:330 , LEU X:450 , THR X:452BINDING SITE FOR RESIDUE NA X 802
5AC5SOFTWARETYR X:233 , ILE X:243 , ASP X:244 , ALA X:460 , THR X:461 , TYR X:462 , HOH X:819BINDING SITE FOR RESIDUE NA X 803
6AC6SOFTWARESER X:294 , SER X:296 , LYS X:703 , HOH X:845BINDING SITE FOR RESIDUE PG4 X 804

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1T6B)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Tyr X:411 -Pro X:412

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 8)

Asymmetric/Biological Unit (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_022687L45PANTR2_HUMANDisease (HFS)  ---YL45P
2UniProtVAR_022688G105DANTR2_HUMANDisease (HFS)137852902YG105D
3UniProtVAR_022689I189TANTR2_HUMANDisease (HFS)137852905YI189T
4UniProtVAR_PAG_BACAN_001 *M295IPAG_BACAN  ---  ---XM266I
5UniProtVAR_PAG_BACAN_002 *N392DPAG_BACAN  ---  ---XN363D
6UniProtVAR_PAG_BACAN_003 *F560LPAG_BACAN  ---  ---XF531L
7UniProtVAR_PAG_BACAN_004 *P565SPAG_BACAN  ---  ---XP536S
8UniProtVAR_PAG_BACAN_005 *A600VPAG_BACAN  ---  ---XA571V
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1VWFAPS50234 VWFA domain profile.ANTR2_HUMAN44-213  1Y:44-210

(-) Exons   (7, 7)

Asymmetric/Biological Unit (7, 7)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.8dENST000003073338dENSE00001871464chr4:80993717-80993563155ANTR2_HUMAN1-51511Y:41-5111
1.9aENST000003073339aENSE00001761580chr4:80992808-8099273772ANTR2_HUMAN51-75251Y:51-7525
1.10ENST0000030733310ENSE00001798474chr4:80990661-8099059072ANTR2_HUMAN75-99251Y:75-9925
1.11ENST0000030733311ENSE00001123454chr4:80977167-8097708682ANTR2_HUMAN99-126281Y:99-12628
1.12ENST0000030733312ENSE00001123446chr4:80976621-80976514108ANTR2_HUMAN127-162361Y:127-16236
1.13ENST0000030733313ENSE00001123438chr4:80976372-8097630469ANTR2_HUMAN163-185231Y:163-18523
1.14bENST0000030733314bENSE00001123430chr4:80975506-8097542681ANTR2_HUMAN186-212271Y:186-21025
1.15ENST0000030733315ENSE00001123421chr4:80957186-8095712661ANTR2_HUMAN213-233210--
1.16ENST0000030733316ENSE00001123410chr4:80954724-8095462699ANTR2_HUMAN233-266340--
1.17ENST0000030733317ENSE00001123400chr4:80952846-8095277770ANTR2_HUMAN266-289240--
1.19ENST0000030733319ENSE00001712373chr4:80940130-8094005279ANTR2_HUMAN289-315270--
1.20ENST0000030733320ENSE00001665059chr4:80929770-8092967596ANTR2_HUMAN316-347320--
1.21ENST0000030733321ENSE00001771910chr4:80906017-8090597345ANTR2_HUMAN348-362150--
1.22ENST0000030733322ENSE00001710470chr4:80905124-8090503293ANTR2_HUMAN363-393310--
1.23ENST0000030733323ENSE00001599114chr4:80899328-80899161168ANTR2_HUMAN394-449560--
1.24bENST0000030733324bENSE00001257764chr4:80898855-80898733123ANTR2_HUMAN450-489400--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain X from PDB  Type:PROTEIN  Length:676
 aligned with PAG_BACAN | P13423 from UniProtKB/Swiss-Prot  Length:764

    Alignment length:720
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734       744       754       764
            PAG_BACAN    45 SQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764
               SCOP domains d1t6bx2 X:16-225 PA14                                                                                                                                                                                             d1t6bx1 X:226-735 Anthrax protective antigen C-ter            minal-like                                                                                                                                                                                                                                                                                                                                                                                                                                                       SCOP domains
               CATH domains 1t6bX01 X:16-258 Toxin - Anthrax Protective Antigen;domain 1                                                                                                                                                                                       1t6bX02 X:259-485              [code=2.60.120                .240, no name defined]                                                                                                                                                1t6bX03 X:486-604  [code=3.10.20.110, no name defined]                                                                 1t6bX04 X:605-735  [code=2.60.40.810, no name defined]                                                                              CATH domains
               Pfam domains PA14-1t6bX01 X:16-150                                                                                                                  --------                Binary_toxB-1t6bX02 X:175-599                                                                                                                                                                                                                                                                                                                                                                                                            ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.......eeeeeee.......hhhhhh..hhhhhh..eeeeeeeee....eeeeeee.hhh.eeeee..eeeee.......eee....eeeeeeeee............eeee.....eee.....ee......----------------.........hhhhhhhheeeee....eeeee.hhhhhh.....................hhhhhhhh.......hhhhh........eeeeeeeeeeee..------------.eeeeeeeee......----------------........eeeeeee..........hhhhhhh.....eeeeeeeeeeee............eeeee...eeeeee..............eee.......ee...........eeeehhhhhhhhhhheeeeee.....eeeeee....eeeeeeeeehhhhhhhhhhheeeeee.......eeeeee...............hhhhhhhhhhh........ee..ee...eeeeehhhhhhhhhhhhhhh...hhhhhh.........eeeeee..eee.....eeeehhhhhhhhh....eee..eeee..hhhhhhheeeeeeeee.....eee..........eee.....eeee.hhhh............eeeeeeee.hhh.................eeeeeeehhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I------------------------------------------------------------------------------------------------D-----------------------------------------------------------------------------------------------------------------------------------------------------------------------L----S----------------------------------V-------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1t6b X  16 SQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQ----------------VPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNE------------TISKNTSTSRTHTSEV----------------VSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 735
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155  |      -       175       185       195       205       215       225       235       245       255       265       275         -  |    295       | -         -    |  325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675       685       695       705       715       725       735
                                                                                                                                                                        158              175                                                                                                 275          288            303              320                                                                                                                                                                                                                                                                                                                                                                                                                               

Chain Y from PDB  Type:PROTEIN  Length:170
 aligned with ANTR2_HUMAN | P58335 from UniProtKB/Swiss-Prot  Length:489

    Alignment length:170
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
          ANTR2_HUMAN    41 RAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGII 210
               SCOP domains d1t6by_ Y: Capillary morphogenesis protein 2 domain                                                                                                                        SCOP domains
               CATH domains 1t6bY00 Y:41-210  [code=3.40.50.410, no name defined]                                                                                                                      CATH domains
               Pfam domains ---VWA-1t6bY01 Y:44-210                                                                                                                                                    Pfam domains
         Sec.struct. author ...eeeeeee.hhhhhhhhhhhhhhhhhhhhhh.....eeeeeee...eeeeeeee.hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.eeeeeee......hhhhhhhhhhhhhhhh.eeeeeee....hhhhhhh...hhh.eee..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----P-----------------------------------------------------------D-----------------------------------------------------------------------------------T--------------------- SAPs(SNPs)
                    PROSITE ---VWFA  PDB: Y:44-210 UniProt: 44-213                                                                                                                                     PROSITE
           Transcript 1 (1) Exon 1.8d  -----------------------Exon 1.10  PDB: Y:75-99  ---------------------------Exon 1.12  PDB: Y:127-162           Exon 1.13              Exon 1.14b  PDB: Y:186-21 Transcript 1 (1)
           Transcript 1 (2) ----------Exon 1.9a  PDB: Y:51-75  -----------------------Exon 1.11  PDB: Y:99-126    ------------------------------------------------------------------------------------ Transcript 1 (2)
                 1t6b Y  41 RAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGII 210
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (5, 5)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Clan: PA14 (11)
(-)
Clan: vWA-like (60)

(-) Gene Ontology  (27, 32)

Asymmetric/Biological Unit(hide GO term definitions)
Chain X   (PAG_BACAN | P13423)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0043409    negative regulation of MAPK cascade    Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the MAPKKK cascade.
    GO:0010629    negative regulation of gene expression    Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0001933    negative regulation of protein phosphorylation    Any process that stops, prevents or reduces the rate of addition of phosphate groups to amino acids within a protein.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
    GO:0044533    positive regulation of apoptotic process in other organism    Any process in which an organism activates, maintains or increases the frequency, rate or extent of programmed cell death by apoptosis in a second organism.
    GO:0097300    programmed necrotic cell death    A necrotic cell death process that results from the activation of endogenous cellular processes, such as signaling involving death domain receptors or Toll-like receptors.
    GO:0051260    protein homooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0035897    proteolysis in other organism    The chemical reactions and pathways performed by an organism resulting in the hydrolysis of proteins in another organism by cleavage of their peptide bonds.
    GO:1903140    regulation of establishment of endothelial barrier    Any process that modulates the frequency, rate or extent of establishment of endothelial barrier.
    GO:0061136    regulation of proteasomal protein catabolic process    Any process that modulates the rate, frequency, or extent of the chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome.
cellular component
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain Y   (ANTR2_HUMAN | P58335)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
biological process
    GO:0022414    reproductive process    A biological process that directly contributes to the process of producing new individuals by one or two organisms. The new individuals inherit some proportion of their genetic material from the parent or parents.
    GO:1901998    toxin transport    The directed movement of a toxin into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Tyr X:411 - Pro X:412   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1t6b
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANTR2_HUMAN | P58335
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PAG_BACAN | P13423
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  228600
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ANTR2_HUMAN | P58335
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PAG_BACAN | P13423
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANTR2_HUMAN | P583351sht 1shu 1tx5 1tzn
        PAG_BACAN | P134231acc 1tx5 1tzn 1tzo 1v36 3etb 3ino 3j9c 3kwv 3mhz 3q8a 3q8b 3q8c 3q8e 3q8f 3tew 3tex 3tey 3tez 4ee2 4h2a 4nam 5fr3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1T6B)