|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1SVY) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1SVY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SVY) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1SVY) |
Exons (0, 0)| (no "Exon" information available for 1SVY) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:102 aligned with SEVE_DICDI | P10733 from UniProtKB/Swiss-Prot Length:362 Alignment length:102 167 177 187 197 207 217 227 237 247 257 SEVE_DICDI 158 EYKPRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLLGGKGAIAAKH 259 SCOP domains d1svya_ A: Severin, domain 2 SCOP domains CATH domains 1svyA00 A:158-259 Severin CATH domains Pfam domains ------------Gelsolin-1svyA01 A:170-246 ------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------ Transcript 1svy A 158 EYKPRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFcETDSDIPAEFWKLLGGKGAIAAKH 259 167 177 187 197 207 217 227 237 247 257 235-CSO
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (10, 10)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (SEVE_DICDI | P10733)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|