|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 11)
Asymmetric Unit (3, 11)
|
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1SFX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1SFX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SFX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1SFX) |
Exons (0, 0)| (no "Exon" information available for 1SFX) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:109 aligned with O28271_ARCFU | O28271 from UniProtKB/TrEMBL Length:106 Alignment length:109 1 106 | 9 19 29 39 49 59 69 79 89 99 | O28271_ARCFU - -MSNPLGELVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTD-- - SCOP domains d1sfxa_ A: Hypothetical protein AF2008 SCOP domains CATH domains 1sfxA00 A:0-108 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 1sfx A 0 HmSNPLGELVKALEKLSFKPSDVRIYSLLLERGGmRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKmFTDGS 108 | 9 19 29 | 39 49 59 69 79 89 99 | | 34-MSE 103-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:104 aligned with O28271_ARCFU | O28271 from UniProtKB/TrEMBL Length:106 Alignment length:104 11 21 31 41 51 61 71 81 91 101 O28271_ARCFU 2 SNPLGELVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFT 105 SCOP domains d1sfxb_ B: Hypothetical protein AF2008 SCOP domains CATH domains 1sfxB00 B:2-105 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) ----------TrmB-1sfxB01 B:12-83 ---------------------- Pfam domains (1) Pfam domains (2) ----------TrmB-1sfxB02 B:12-83 ---------------------- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 1sfx B 2 SNPLGELVKALEKLSFKPSDVRIYSLLLERGGmRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKmFT 105 11 21 31 | 41 51 61 71 81 91 101 | 34-MSE 103-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)
Asymmetric Unit
|
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1SFX)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|