Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CUPIN DOMAIN PROTEIN EF2996 FROM ENTEROCOCCUS FAECALIS
 
Authors :  A. A. Fedorov, E. V. Fedorov, S. C. Almo, S. K. Burley, New York Sgx Res Center For Structural Genomics (Nysgxrc)
Date :  17 Feb 04  (Deposition) - 22 Jun 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (8x)
Keywords :  Structural Genomics, Nysgxrc Target T1582, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. A. Fedorov, E. V. Fedorov, S. C. Almo
The Crystal Structure Of Conserved Hypothetical Protein Fro Enterococcus Faecalis V583
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CONSERVED HYPOTHETICAL PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificENTEROCOCCUS FAECALIS
    Organism Taxid226185
    Other DetailsTHE CONSERVED HYPOTHETICAL PROTEIN WITH UNKNOWN FUNCTION
    StrainV583

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (8x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SEF)

(-) Sites  (0, 0)

(no "Site" information available for 1SEF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SEF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SEF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SEF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SEF)

(-) Exons   (0, 0)

(no "Exon" information available for 1SEF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:250
 aligned with Q82ZQ3_ENTFA | Q82ZQ3 from UniProtKB/TrEMBL  Length:261

    Alignment length:250
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261
         Q82ZQ3_ENTFA    12 KELLTSRAVIKKDNYAIIPHDGLVQNAVPGFENVDISILGSPKLGATFVDYIATFHKNGQQTTGFGGDGIQTLVYVIDGRLRVSDGQETHELEAGGYAYFTPEMKMYLANAQEADTEVFLYKKRYQPLAGHQPYKVVGSIHDQQPEEYEGMTDVLLWSLLPKEFDFDMNMHILSFEPGASHAYIETHVQEHGAYLISGQGMYNLDNEWYPVEKGDYIFMSAYVPQAAYAVGREEPLMYVYSKDANREPEL 261
               SCOP domains d1sefa_ A: Hypothetical protein EF2996                                                                                                                                                                                                                     SCOP domains
               CATH domains 1sefA01 Jelly Rolls     1sefA02 A:39-157 Jelly Rolls                                                                                           1sefA01 A:15-38,A:158-264 Jelly Rolls                                                                       CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------Cupin_2-1sefA01 A:185-255                                              --------- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------Cupin_2-1sefA02 A:185-255                                              --------- Pfam domains (2)
         Sec.struct. author ........eee...eeeehhhhh.......eeeeeeee..hhhhh...eeeeeeeeeeeee........eeeeeeeee.eeeee....eeeee..eeeee......eeee.....eeeeeeeee...........eeee.hhh..ee.hhh..eeeee.........eeeeeeee...............eeeeeee.eeeeee..eeeeee...eeee.....eeeeee.....eeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sef A  15 KELLTSRAVIKKDNYAIIPHDGLVQNAVPGFENVDISILGSPKLGATFVDYIATFHKNGQQTTGFGGDGIQTLVYVIDGRLRVSDGQETHELEAGGYAYFTPEMKMYLANAQEADTEVFLYKKRYQPLAGHQPYKVVGSIHDQQPEEYEGMTDVLLWSLLPKEFDFDMNMHILSFEPGASHAYIETHVQEHGAYLISGQGMYNLDNEWYPVEKGDYIFMSAYVPQAAYAVGREEPLMYVYSKDANREPEL 264
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Cupin (179)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1SEF)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sef)
 
  Sites
(no "Sites" information available for 1sef)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sef)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sef
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q82ZQ3_ENTFA | Q82ZQ3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q82ZQ3_ENTFA | Q82ZQ3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SEF)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SEF)