Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PUTATIVE CYTOPLASMIC PROTEIN FROM SALMONELLA TYPHIMURIUM
 
Authors :  M. E. Cuff, H. Li, F. Collart, A. Joachimiak, Midwest Center For Stru Genomics (Mcsg)
Date :  16 Jan 04  (Deposition) - 29 Jun 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Mcsg, Salmonella Typhimurium, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. E. Cuff, H. Li, F. Collart, A. Joachimiak
Putative Cytoplasmic Protein From Salmonella Typhimurium
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE CYTOPLASMIC PROTEIN YDIL
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPMAGIC
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    GeneYDIL
    Organism ScientificSALMONELLA TYPHIMURIUM
    Organism Taxid99287
    StrainLT2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 10)

Asymmetric/Biological Unit (1, 10)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1S4K)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1S4K)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S4K)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1S4K)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1S4K)

(-) Exons   (0, 0)

(no "Exon" information available for 1S4K)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:120
 aligned with Q8ZPR1_SALTY | Q8ZPR1 from UniProtKB/TrEMBL  Length:119

    Alignment length:120
                             1                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119
         Q8ZPR1_SALTY     - -MMNALELQALRRIFDMTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEMKARRQRRINAIVDKINNRIGNNTMRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119
               SCOP domains d1s4ka_ A: Putative cytoplasmic protein YdiL                                                                             SCOP domains
               CATH domains 1s4kA00 A:0-119 Putative cytoplasmic protein                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh..hhhhhhhhh....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh......eee...hhhhhhh.....hhhhhhhhhhhhhhhhhh...eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1s4k A   0 AmmNALELQALRRIFDmTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEmKARRQRRINAIVDKINNRIGNNTmRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119
                             ||      9      | 19        29        39        49     |  59        69        79        89        99       109       119
                             ||            16-MSE                                 55-MSE                  79-MSE                                    
                             1-MSE                                                                                                                  
                              2-MSE                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with Q8ZPR1_SALTY | Q8ZPR1 from UniProtKB/TrEMBL  Length:119

    Alignment length:120
                             1                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119
         Q8ZPR1_SALTY     - -MMNALELQALRRIFDMTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEMKARRQRRINAIVDKINNRIGNNTMRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119
               SCOP domains d1s4kb_ B: Putative cytoplasmic protein YdiL                                                                             SCOP domains
               CATH domains 1s4kB00 B:0-119 Putative cytoplasmic protein                                                                             CATH domains
           Pfam domains (1) --DUF1870-1s4kB01 B:2-119                                                                                                Pfam domains (1)
           Pfam domains (2) --DUF1870-1s4kB02 B:2-119                                                                                                Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhh..hhhhhhhhh....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee....hhhhhhh.....hhhhhhhhhhhhhhhhhh...ee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1s4k B   0 AmmNALELQALRRIFDmTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEmKARRQRRINAIVDKINNRIGNNTmRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119
                             ||      9      | 19        29        39        49     |  59        69        79        89        99       109       119
                             1-MSE         16-MSE                                 55-MSE                  79-MSE                                    
                              2-MSE                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q8ZPR1_SALTY | Q8ZPR1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1s4k)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s4k)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s4k
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8ZPR1_SALTY | Q8ZPR1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8ZPR1_SALTY | Q8ZPR1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1S4K)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1S4K)