1S3J - JenaLib

Title :   X-RAY CRYSTAL STRUCTURE OF YUSO PROTEIN FROM BACILLUS SUBTILIS

Authors :   J. Osipiuk, R. Wu, S. Moy, F. Collart, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)

Date :   13 Jan 04 (Deposition) - 13 Apr 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.25

Chains :   Asym./Biol. Unit : A,B

Keywords :   Structural Genomics, Yuso Protein, Marr Transcriptional Regulator Family, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Osipiuk, R. Wu, S. Moy, F. Collart, A. Joachimiak
X-Ray Crystal Structure Of Yuso Protein From Bacillus Subtilis, A Member Of Marr Transcriptional Regulator Family
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 14)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:143
 aligned with YUSO_BACSU | O32181 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:143
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142   
           YUSO_BACSU     3 SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD 145
               SCOP domains d1s3ja_ A: Putative transcriptional regulator YusO                                                                                              SCOP domains
               CATH domains 1s3jA01 A:3-34                  1s3jA02 A:35-98 'winged helix' repressor DNA binding domain     1s3jA03 A:99-145                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhheeehhhhhhhhh.hhhhhhhhhhhhhhh..eeeee.......eeeeehhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -HTH_MARR_2  PDB: A:4-140 UniProt: 4-140                                                                                                  ----- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s3j A   3 SADQLmSDIQLSLQALFQKIQPEmLESmEKQGVTPAQLFVLASLKKHGSLKVSEIAERmEVKPSAVTLmADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAImARYLSFLTEEEmLQAAHITAKLAQAAETD 145
                                 |  12        22   |   |32        42        52        62        72        82        92       102       112   |   122     | 132       142   
                                 8-MSE            26-MSE                             61-MSE    71-MSE                                      116-MSE     128-MSE             
                                                      30-MSE

Chain B from PDB  Type:PROTEIN  Length:141
 aligned with YUSO_BACSU | O32181 from UniProtKB/Swiss-Prot  Length:155

    Alignment length:141
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141 
           YUSO_BACSU     2 KSADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAA 142
               SCOP domains d1s3jb_ B: Putative transcriptional regulator YusO                                                                                            SCOP domains
               CATH domains 1s3jB01 B:2-34                   1s3jB02 B:35-98 'winged helix' repressor DNA binding domain     1s3jB03 B:99-142                             CATH domains
           Pfam domains (1) ---------------------------------MarR-1s3jB01 B:35-93                                       ------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------------MarR-1s3jB02 B:35-93                                       ------------------------------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhheeehhhhhhhhh.hhhhhhhhhhhhhhh..eeeee.......eeeeehhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --HTH_MARR_2  PDB: B:4-140 UniProt: 4-140                                                                                                  -- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s3j B   2 KSADQLmSDIQLSLQALFQKIQPEmLESmEKQGVTPAQLFVLASLKKHGSLKVSEIAERmEVKPSAVTLmADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAImARYLSFLTEEEmLQAAHITAKLAQAA 142
                                  | 11        21    |   31        41        51        61        71        81        91       101       111    |  121      |131       141 
                                  8-MSE            26-MSE                             61-MSE    71-MSE                                      116-MSE     128-MSE          
                                                       30-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (3, 6)

Pfam Domains (1, 2)

Gene Ontology (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (YUSO_BACSU | O32181)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1s3j
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	YUSO_BACSU \| O32181
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description