|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (1, 4) Biological Unit 2 (1, 48) Biological Unit 3 (1, 48) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1RO5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1RO5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1RO5) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1RO5) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:197 aligned with LASI_PSEAE | P33883 from UniProtKB/Swiss-Prot Length:201 Alignment length:200 1 | 7 17 27 37 47 57 67 77 87 97 107 117 127 137 147 157 167 177 187 197 LASI_PSEAE - ---MIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDTPEAQVFGCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQR 197 SCOP domains d1ro5a_ A: Autoinducer synthesis protein LasI SCOP domains CATH domains ---1ro5A01 A:1-190 [code=3.40.630.30, no name defined] ------- CATH domains Pfam domains ----------Autoind_synth-1ro5A01 A:8-189 -------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---AUTOINDUCER_SYNTH_2 PDB: A:1-189 UniProt: 1-189 -------- PROSITE (1) PROSITE (2) ------------------------AUTOINDUCER_SYNTH_1 ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ro5 A 397 GSHMIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDG---QVFGCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQR 197 || 7 17 27 37 47 57 | | 67 77 87 97 107 117 127 137 147 157 167 177 187 197 || 60G 64 399| 1
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (LASI_PSEAE | P33883)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|