Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  RIBGRASS MOSAIC VIRUS, FIBER DIFFRACTION
 
Authors :  H. Wang, G. Stubbs
Date :  11 Feb 97  (Deposition) - 15 May 97  (Release) - 24 Feb 09  (Revision)
Method :  FIBER DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (49x)
Keywords :  Ribgrass Mosaic Virus, Tobamovirus, Rmv Cluster, Coat Protein (Viral), Complex (Coat Protein/Rna), Helical Virus, Virus/Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Wang, G. Stubbs
Molecular Dynamics In Refinement Against Fiber Diffraction Data.
Acta Crystallogr. , Sect. A V. 49 504 1993
PubMed-ID: 8129880  |  Reference-DOI: 10.1107/S0108767392011255
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RIBGRASS MOSAIC VIRUS RNA
    Chains: B
    Fragment: GAA
    Organism Scientific: RIBGRASS MOSAIC VIRUS
    Organism Taxid: 51680
 
Molecule 2 - RIBGRASS MOSAIC VIRUS COAT PROTEIN
    Chains: A
    Organism Scientific: RIBGRASS MOSAIC VIRUS
    Organism Taxid: 51680

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (49x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1ACE-1Mod. Amino AcidACETYL GROUP

(-) Sites  (0, 0)

(no "Site" information available for 1RMV)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1RMV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1RMV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1RMV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1RMV)

(-) Exons   (0, 0)

(no "Exon" information available for 1RMV)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:157
 aligned with CAPSD_RMVHR | P03580 from UniProtKB/Swiss-Prot  Length:157

    Alignment length:157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       
          CAPSD_RMVHR     1 MSYNITNSNQYQYFAAVWAEPTPMLNQCVSALSQSYQTQAGRDTVRQQFANLLSTIVAPNQRFPDTGFRVYVNSAVIKPLYEALMKSFDTRNRIIETEEESRPSASEVANATQRVDDATVAIRSQIQLLLNELSNGHGYMNRAEFEAILPWTTAPAT 157
               SCOP domains d1rmva_ A: Ribgrass mosaic virus                                                                                                                              SCOP domains
               CATH domains -1rmvA00 A:1-156  [code=1.20.120.70, no name defined]                                                                                                         CATH domains
               Pfam domains -TMV_coat-1rmvA01 A:1-145                                                                                                                         ----------- Pfam domains
         Sec.struct. author ...................hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh...............ee.....hhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhh...ee................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rmv A   0 xSYNITNSNQYQYFAAVWAEPTPMLNQCVSALSQSYQTQAGRDTVRQQFANLLSTIVAPNQRFPDTGFRVYVNSAVIKPLYEALMKSFDTRNRIIETEEESRPSASEVANATQRVDDATVAIRSQIQLLLNELSNGHGYMNRAEFEAILPWTTAPAT 156
                            |        9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       
                            |                                                                                                                                                            
                            0-ACE                                                                                                                                                        


Chain B from PDB  Type:RNA  Length:3
                                   
                 1rmv B 165 GAA 167
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: TMV_coat] (6)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A   (CAPSD_RMVHR | P03580)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
    GO:0019029    helical viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles; the subunits are arranged to form a protein helix with the genetic material contained within. Tobacco mosaic virus has such a capsid structure.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1rmv)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1rmv)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1rmv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAPSD_RMVHR | P03580
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAPSD_RMVHR | P03580
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1RMV)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1RMV)