|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 20)
Asymmetric Unit (4, 20)
|
Sites (20, 20)
Asymmetric Unit (20, 20)
|
SS Bonds (17, 17)
Asymmetric Unit
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1RFX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1RFX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1RFX) |
Exons (0, 0)| (no "Exon" information available for 1RFX) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:89 aligned with RETN_MOUSE | Q99P87 from UniProtKB/Swiss-Prot Length:114 Alignment length:89 35 45 55 65 75 85 95 105 RETN_MOUSE 26 CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS 114 SCOP domains d1rfxa_ A: Resistin (ADSF, FIZZ3) SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1rfx A 6 CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS 94 15 25 35 45 55 65 75 85 Chain B from PDB Type:PROTEIN Length:89 aligned with RETN_MOUSE | Q99P87 from UniProtKB/Swiss-Prot Length:114 Alignment length:89 35 45 55 65 75 85 95 105 RETN_MOUSE 26 CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS 114 SCOP domains d1rfxb_ B: Resistin (ADSF, FIZZ3) SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1rfx B 6 CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS 94 15 25 35 45 55 65 75 85 Chain C from PDB Type:PROTEIN Length:89 aligned with RETN_MOUSE | Q99P87 from UniProtKB/Swiss-Prot Length:114 Alignment length:89 35 45 55 65 75 85 95 105 RETN_MOUSE 26 CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS 114 SCOP domains d1rfxc_ C: Resistin (ADSF, FIZZ3) SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains (1) Resistin-1rfxC01 C:6-90 ---- Pfam domains (1) Pfam domains (2) Resistin-1rfxC02 C:6-90 ---- Pfam domains (2) Pfam domains (3) Resistin-1rfxC03 C:6-90 ---- Pfam domains (3) SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1rfx C 6 CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS 94 15 25 35 45 55 65 75 85
|
||||||||||||||||||||
SCOP Domains (1, 3)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1RFX) |
Pfam Domains (1, 3)
Asymmetric Unit
|
Gene Ontology (15, 15)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (RETN_MOUSE | Q99P87)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|