|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1R0U) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1R0U) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1R0U) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1R0U) |
Exons (0, 0)| (no "Exon" information available for 1R0U) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:142 aligned with YWIB_BACSU | O07624 from UniProtKB/Swiss-Prot Length:142 Alignment length:146 1 | 4 14 24 34 44 54 64 74 84 94 104 114 124 134 YWIB_BACSU - ------MKQETPITLHVKSVIEDDGNQEVIEFRTTGFYYVKQNKVYLSYYEEHDLGKVKTIVKVSEGEVLVMRSGAVKMNQRFVTGASTIAKYKMSFGELELKTSTKSIQSDLDEEKGRISIAYDMHVGDEQEHLHNMTITYEGGT 140 SCOP domains d1r0ua_ A: Hypothetical protein YwiB SCOP domains CATH domains 1r0uA00 A:-6-140 [code=2.40.128.20, no name defined] CATH domains Pfam domains ------------DUF1934-1r0uA01 A:7-134 ------ Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1r0u A -6 GFQSNAMKQETPITLHVKSVIEDDGNQEVIEFRTTGFYYVKQNKVYLSYYEEHDLGKVKTIVKVSEGEVLVMRSGAVKMNQRFVTGASTIAKYKMSFGELELKTSTKSIQSDLDEEKGRISIAYDMHVG----HLHNMTITYEGGT 140 || 4 14 24 34 44 54 64 74 84 94 104 114 |- | 134 -1| 123 128 1
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1R0U)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|