Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE ONCOPROTEIN P13MTCP1
 
Authors :  L. Guignard, A. Padilla, J. Mispelter, Y-S. Yang, M-H. Stern, J- M. Lhoste, C. Roumestand
Date :  29 Jun 99  (Deposition) - 19 Jan 01  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Beta Barrel, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Guignard, A. Padilla, J. Mispelter, Y. S. Yang, M. H. Stern, J. M. Lhoste, C. Roumestand
Backbone Dynamics And Solution Structure Refinement Of The 15N-Labeled Human Oncogenic Protein P13Mtcp1: Comparison With X-Ray Data.
J. Biomol. Nmr V. 17 215 2000
PubMed-ID: 10959629  |  Reference-DOI: 10.1023/A:1008386110930
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (PRODUCT OF THE MTCP1 ONCOGENE)
    Cell: T-CELLS
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Cell: BL21
    Expression System Taxid: 562
    Expression System Vector: PGEX-2T
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1QTU)

(-) Sites  (0, 0)

(no "Site" information available for 1QTU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QTU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QTU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1QTU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1QTU)

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2bENST000003694762bENSE00001852005X:154299501-154298969533MTCP1_HUMAN-00--
1.3ENST000003694763ENSE00001622983X:154294332-154294181152MTCP1_HUMAN1-35351A:3-3735
1.4ENST000003694764ENSE00001598211X:154294064-154293894171MTCP1_HUMAN36-92571A:38-9457
1.5aENST000003694765aENSE00001661504X:154293812-15429376152MTCP1_HUMAN93-107151A:95-10915
1.6eENST000003694766eENSE00001450119X:154293674-1542923091366MTCP1_HUMAN-00--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:115
 aligned with MTCP1_HUMAN | P56278 from UniProtKB/Swiss-Prot  Length:107

    Alignment length:115
                              1                                                                                                       107      
                              |      8        18        28        38        48        58        68        78        88        98        |-     
          MTCP1_HUMAN     - --MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD------   -
               SCOP domains d1qtua_ A: p13-MTCP1                                                                                                SCOP domains
               CATH domains 1qtuA00 A:1-115 Proto-oncogene - Oncogene Product P14tcl1;                                                          CATH domains
               Pfam domains --TCL1_MTCP1-1qtuA01 A:3-108                                                                                ------- Pfam domains
         Sec.struct. author .............eeeeee..eee.....eeeeeeeee..eeeeeeee.........hhhhhhhh....eeeee...eeee....eeeeeeeeee..eeeeeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 --Exon 1.3  PDB: A:3-37 UniProt: 1-35Exon 1.4  PDB: A:38-94 UniProt: 36-92                    Exon 1.5a      ------ Transcript 1
                 1qtu A   1 GSMAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDDRSPGIH 115
                                    10        20        30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: TCL1_MTCP1] (3)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (MTCP1_HUMAN | P56278)
biological process
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
cellular component
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qtu)
 
  Sites
(no "Sites" information available for 1qtu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qtu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qtu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MTCP1_HUMAN | P56278
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MTCP1_HUMAN | P56278
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MTCP1_HUMAN | P56278: 1a1x 1qtt

(-) Related Entries Specified in the PDB File

1a1x 1A1X CONTAINS THE RX STRUCTURE OF P13MTCP1