|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)
Asymmetric Unit (3, 4)
|
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1QHQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1QHQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1QHQ) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1QHQ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:139 aligned with AURB_CHLAA | P27197 from UniProtKB/Swiss-Prot Length:235 Alignment length:139 106 116 126 136 146 156 166 176 186 196 206 216 226 AURB_CHLAA 97 ANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP 235 SCOP domains d1qhqa_ A: Auracyanin SCOP domains CATH domains 1qhqA00 A:2-140 Cupredoxins - blue copper proteins CATH domains Pfam domains ---------------Copper-bind-1qhqA01 A:17-139 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------------------------------------------------------------------------------------------------------------------MULTICOPPER_OXIDASE1 ---- PROSITE (1) PROSITE (2) ------------------------------------------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1qhq A 2 ANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP 140 11 21 31 41 51 61 71 81 91 101 111 121 131
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (AURB_CHLAA | P27197)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|