Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN DT-DIAPHORASE (NAD(P)H OXIDOREDUCTASE)
 
Authors :  J. V. Skelly, M. R. Sanderson, D. A. Suter, U. Baumann, D. S. Gregory, M. B S. M. Hobbs, S. Neidle
Date :  20 Apr 99  (Deposition) - 24 Apr 00  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  C,D  (1x)
Biol. Unit 6:  A,B  (1x)
Keywords :  Quinone, Fad, Oxidoreductase, Dt-Diaphorase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. V. Skelly, M. R. Sanderson, D. A. Suter, U. Baumann, M. A. Read, D. S. Gregory, M. Bennett, S. M. Hobbs, S. Neidle
Crystal Structure Of Human Dt-Diaphorase: A Model For Interaction With The Cytotoxic Prodrug 5-(Aziridin-1-Yl)-2, 4-Dinitrobenzamide (Cb1954).
J. Med. Chem. V. 42 4325 1999
PubMed-ID: 10543876  |  Reference-DOI: 10.1021/JM991060M

(-) Compounds

Molecule 1 - NAD(P)H DEHYDROGENASE [QUINONE] 1
    ChainsA, B, C, D
    EC Number1.6.99.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDT-DIAPHORASE (NAD(P)H OXIDOREDUCTASE (QUINONE), QUINONE REDUCTASE, DT-DIAPHORASE, DTD, NAD(P)H MENADIONE OXIDOREDUCTASE 1, DIOXIN-INDUCIBLE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D
Biological Unit 5 (1x)  CD
Biological Unit 6 (1x)AB  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1FAD4Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 5 (1, 2)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
Biological Unit 6 (1, 2)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:11 , THR A:15 , SER A:16 , PHE A:17 , ASN A:18 , ALA A:20 , PRO A:102 , LEU A:103 , GLN A:104 , TRP A:105 , PHE A:106 , THR A:147 , THR A:148 , GLY A:149 , GLY A:150 , TYR A:155 , ILE A:192 , ARG A:200 , LEU A:204BINDING SITE FOR RESIDUE FAD A 501
2AC2SOFTWAREHIS B:11 , THR B:15 , SER B:16 , PHE B:17 , ASN B:18 , ALA B:20 , PRO B:102 , LEU B:103 , GLN B:104 , TRP B:105 , PHE B:106 , THR B:147 , THR B:148 , GLY B:149 , GLY B:150 , TYR B:155 , ILE B:192 , ARG B:200BINDING SITE FOR RESIDUE FAD B 601
3AC3SOFTWARETYR C:67 , GLU C:117 , HIS D:11 , THR D:15 , SER D:16 , PHE D:17 , ASN D:18 , ALA D:20 , PRO D:102 , LEU D:103 , GLN D:104 , TRP D:105 , PHE D:106 , THR D:147 , THR D:148 , GLY D:149 , GLY D:150 , TYR D:155 , ILE D:192 , ARG D:200 , LEU D:204BINDING SITE FOR RESIDUE FAD D 701
4AC4SOFTWAREHIS C:11 , THR C:15 , SER C:16 , PHE C:17 , ASN C:18 , ALA C:20 , PRO C:102 , LEU C:103 , GLN C:104 , TRP C:105 , PHE C:106 , THR C:147 , THR C:148 , GLY C:149 , GLY C:150 , TYR C:155 , ILE C:192 , ARG C:200 , LEU C:204BINDING SITE FOR RESIDUE FAD C 801

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QBG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QBG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 12)

Asymmetric Unit (3, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016170R139WNQO1_HUMANPolymorphism1131341A/B/C/DR138W
2UniProtVAR_008384P187SNQO1_HUMANPolymorphism1800566A/B/C/DP186S
3UniProtVAR_050220Q269HNQO1_HUMANPolymorphism34447156A/B/C/DQ268H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016170R139WNQO1_HUMANPolymorphism1131341AR138W
2UniProtVAR_008384P187SNQO1_HUMANPolymorphism1800566AP186S
3UniProtVAR_050220Q269HNQO1_HUMANPolymorphism34447156AQ268H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016170R139WNQO1_HUMANPolymorphism1131341BR138W
2UniProtVAR_008384P187SNQO1_HUMANPolymorphism1800566BP186S
3UniProtVAR_050220Q269HNQO1_HUMANPolymorphism34447156BQ268H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016170R139WNQO1_HUMANPolymorphism1131341CR138W
2UniProtVAR_008384P187SNQO1_HUMANPolymorphism1800566CP186S
3UniProtVAR_050220Q269HNQO1_HUMANPolymorphism34447156CQ268H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016170R139WNQO1_HUMANPolymorphism1131341DR138W
2UniProtVAR_008384P187SNQO1_HUMANPolymorphism1800566DP186S
3UniProtVAR_050220Q269HNQO1_HUMANPolymorphism34447156DQ268H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016170R139WNQO1_HUMANPolymorphism1131341C/DR138W
2UniProtVAR_008384P187SNQO1_HUMANPolymorphism1800566C/DP186S
3UniProtVAR_050220Q269HNQO1_HUMANPolymorphism34447156C/DQ268H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_016170R139WNQO1_HUMANPolymorphism1131341A/BR138W
2UniProtVAR_008384P187SNQO1_HUMANPolymorphism1800566A/BP186S
3UniProtVAR_050220Q269HNQO1_HUMANPolymorphism34447156A/BQ268H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1QBG)

(-) Exons   (6, 23)

Asymmetric Unit (6, 23)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003206231aENSE00001900307chr16:69760707-69760336372NQO1_HUMAN1-333A:2-2
-
C:2-2
D:2-2
1
-
1
1
1.2ENST000003206232ENSE00001241523chr16:69752437-69752273165NQO1_HUMAN3-58564A:2-57
B:3-57
C:2-57
D:2-57
56
55
56
56
1.3ENST000003206233ENSE00001241515chr16:69752156-69752026131NQO1_HUMAN58-101444A:57-100
B:57-100
C:57-100
D:57-100
44
44
44
44
1.4ENST000003206234ENSE00001241509chr16:69748980-69748867114NQO1_HUMAN102-139384A:101-138
B:101-138
C:101-138
D:101-138
38
38
38
38
1.5ENST000003206235ENSE00001241503chr16:69747032-69746931102NQO1_HUMAN140-173344A:139-172
B:139-172
C:139-172
D:139-172
34
34
34
34
1.6cENST000003206236cENSE00001819797chr16:69745184-697433041881NQO1_HUMAN174-2741014A:173-273
B:173-273
C:173-273
D:173-273
101
101
101
101

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:272
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:272
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272  
           NQO1_HUMAN     3 GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbga_ A: NAD(P)H:quinone reductase                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1qbgA00 A:2-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------------------------------------------------Exon 1.3  PDB: A:57-100 UniProt: 58-101     Exon 1.4  PDB: A:101-138              Exon 1.5  PDB: A:139-172          Exon 1.6c  PDB: A:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: A:2-57 UniProt: 3-58                     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg A   2 VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  

Chain B from PDB  Type:PROTEIN  Length:271
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:271
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273 
           NQO1_HUMAN     4 RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbgb_ B: NAD(P)H:quinone reductase                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1qbgB00 B:3-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ------------------------------------------------------Exon 1.3  PDB: B:57-100 UniProt: 58-101     Exon 1.4  PDB: B:101-138              Exon 1.5  PDB: B:139-172          Exon 1.6c  PDB: B:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: B:3-57 UniProt: 3-58 [INCOMPLETE]       ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg B   3 RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272 

Chain C from PDB  Type:PROTEIN  Length:272
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:272
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272  
           NQO1_HUMAN     3 GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbgc_ C: NAD(P)H:quinone reductase                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1qbgC00 C:2-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------------------------------------------------Exon 1.3  PDB: C:57-100 UniProt: 58-101     Exon 1.4  PDB: C:101-138              Exon 1.5  PDB: C:139-172          Exon 1.6c  PDB: C:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: C:2-57 UniProt: 3-58                     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg C   2 VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  

Chain D from PDB  Type:PROTEIN  Length:272
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:272
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272  
           NQO1_HUMAN     3 GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbgd_ D: NAD(P)H:quinone reductase                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1qbgD00 D:2-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                             CATH domains
           Pfam domains (1) -Flavodoxin_2-1qbgD01 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -Flavodoxin_2-1qbgD02 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) -Flavodoxin_2-1qbgD03 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) -Flavodoxin_2-1qbgD04 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author ..eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------------------------------------------------Exon 1.3  PDB: D:57-100 UniProt: 58-101     Exon 1.4  PDB: D:101-138              Exon 1.5  PDB: D:139-172          Exon 1.6c  PDB: D:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: D:2-57 UniProt: 3-58                     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg D   2 VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (26, 26)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (NQO1_HUMAN | P15559)
molecular function
    GO:0003955    NAD(P)H dehydrogenase (quinone) activity    Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a hydroquinone.
    GO:0004128    cytochrome-b5 reductase activity, acting on NAD(P)H    Catalysis of the reaction: NAD(P)H + H+ + 2 ferricytochrome b(5) = NAD(P)+ + 2 ferrocytochrome b(5).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004784    superoxide dismutase activity    Catalysis of the reaction: 2 superoxide + 2 H+ = O2 + hydrogen peroxide.
biological process
    GO:0007568    aging    A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.
    GO:0006809    nitric oxide biosynthetic process    The chemical reactions and pathways resulting in the formation of nitric oxide, nitrogen monoxide (NO), a colorless gas only slightly soluble in water.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0043525    positive regulation of neuron apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
    GO:0006521    regulation of cellular amino acid metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving amino acids.
    GO:0019430    removal of superoxide radicals    Any process, acting at the cellular level, involved in removing superoxide radicals (O2-) from a cell or organism, e.g. by conversion to dioxygen (O2) and hydrogen peroxide (H2O2).
    GO:0032355    response to estradiol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0007584    response to nutrient    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0006979    response to oxidative stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
    GO:0009636    response to toxic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
    GO:0006801    superoxide metabolic process    The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.
    GO:0007271    synaptic transmission, cholinergic    The vesicular release of acetylcholine from a presynapse, across a chemical synapse, the subsequent activation of dopamine receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
    GO:0006805    xenobiotic metabolic process    The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qbg)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qbg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NQO1_HUMAN | P15559
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.6.99.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NQO1_HUMAN | P15559
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NQO1_HUMAN | P155591d4a 1dxo 1gg5 1h66 1h69 1kbo 1kbq 2f1o 3jsx 4cet 4cf6 5a4k 5ea2 5eai 5fuq

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QBG)