1QBG - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN DT-DIAPHORASE (NAD(P)H OXIDOREDUCTASE)

Authors :   J. V. Skelly, M. R. Sanderson, D. A. Suter, U. Baumann, D. S. Gregory, M. B S. M. Hobbs, S. Neidle

Date :   20 Apr 99 (Deposition) - 24 Apr 00 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: C,D  (1x)
Biol. Unit 6: A,B  (1x)

Keywords :   Quinone, Fad, Oxidoreductase, Dt-Diaphorase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. V. Skelly, M. R. Sanderson, D. A. Suter, U. Baumann, M. A. Read, D. S. Gregory, M. Bennett, S. M. Hobbs, S. Neidle
Crystal Structure Of Human Dt-Diaphorase: A Model For Interaction With The Cytotoxic Prodrug 5-(Aziridin-1-Yl)-2, 4-Dinitrobenzamide (Cb1954).
J. Med. Chem. V. 42 4325 1999
PubMed-ID: 10543876 | Reference-DOI: 10.1021/JM991060M

Molecule 1 - NAD(P)H DEHYDROGENASE [QUINONE] 1
	Chains	:	A, B, C, D
	EC Number	:	1.6.99.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	DT-DIAPHORASE (NAD(P)H OXIDOREDUCTASE (QUINONE), QUINONE REDUCTASE, DT-DIAPHORASE, DTD, NAD(P)H MENADIONE OXIDOREDUCTASE 1, DIOXIN-INDUCIBLE

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:			C	D
Biological Unit 6 (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	FAD	4	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	FAD	1	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	FAD	1	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	FAD	1	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	FAD	1	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Biological Unit 5 (1, 2)

No.	Name	Count	Type	Full Name
1	FAD	2	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Biological Unit 6 (1, 2)

No.	Name	Count	Type	Full Name
1	FAD	2	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:11 , THR A:15 , SER A:16 , PHE A:17 , ASN A:18 , ALA A:20 , PRO A:102 , LEU A:103 , GLN A:104 , TRP A:105 , PHE A:106 , THR A:147 , THR A:148 , GLY A:149 , GLY A:150 , TYR A:155 , ILE A:192 , ARG A:200 , LEU A:204	BINDING SITE FOR RESIDUE FAD A 501
2	AC2	SOFTWARE	HIS B:11 , THR B:15 , SER B:16 , PHE B:17 , ASN B:18 , ALA B:20 , PRO B:102 , LEU B:103 , GLN B:104 , TRP B:105 , PHE B:106 , THR B:147 , THR B:148 , GLY B:149 , GLY B:150 , TYR B:155 , ILE B:192 , ARG B:200	BINDING SITE FOR RESIDUE FAD B 601
3	AC3	SOFTWARE	TYR C:67 , GLU C:117 , HIS D:11 , THR D:15 , SER D:16 , PHE D:17 , ASN D:18 , ALA D:20 , PRO D:102 , LEU D:103 , GLN D:104 , TRP D:105 , PHE D:106 , THR D:147 , THR D:148 , GLY D:149 , GLY D:150 , TYR D:155 , ILE D:192 , ARG D:200 , LEU D:204	BINDING SITE FOR RESIDUE FAD D 701
4	AC4	SOFTWARE	HIS C:11 , THR C:15 , SER C:16 , PHE C:17 , ASN C:18 , ALA C:20 , PRO C:102 , LEU C:103 , GLN C:104 , TRP C:105 , PHE C:106 , THR C:147 , THR C:148 , GLY C:149 , GLY C:150 , TYR C:155 , ILE C:192 , ARG C:200 , LEU C:204	BINDING SITE FOR RESIDUE FAD C 801

(no "SS Bond" information available for 1QBG)

(no "Cis Peptide Bond" information available for 1QBG)

Asymmetric Unit (3, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016170	R	139	W	NQO1_HUMAN	Polymorphism	1131341	A/B/C/D	R	138	W
2	UniProt	VAR_008384	P	187	S	NQO1_HUMAN	Polymorphism	1800566	A/B/C/D	P	186	S
3	UniProt	VAR_050220	Q	269	H	NQO1_HUMAN	Polymorphism	34447156	A/B/C/D	Q	268	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016170	R	139	W	NQO1_HUMAN	Polymorphism	1131341	A	R	138	W
2	UniProt	VAR_008384	P	187	S	NQO1_HUMAN	Polymorphism	1800566	A	P	186	S
3	UniProt	VAR_050220	Q	269	H	NQO1_HUMAN	Polymorphism	34447156	A	Q	268	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016170	R	139	W	NQO1_HUMAN	Polymorphism	1131341	B	R	138	W
2	UniProt	VAR_008384	P	187	S	NQO1_HUMAN	Polymorphism	1800566	B	P	186	S
3	UniProt	VAR_050220	Q	269	H	NQO1_HUMAN	Polymorphism	34447156	B	Q	268	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016170	R	139	W	NQO1_HUMAN	Polymorphism	1131341	C	R	138	W
2	UniProt	VAR_008384	P	187	S	NQO1_HUMAN	Polymorphism	1800566	C	P	186	S
3	UniProt	VAR_050220	Q	269	H	NQO1_HUMAN	Polymorphism	34447156	C	Q	268	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016170	R	139	W	NQO1_HUMAN	Polymorphism	1131341	D	R	138	W
2	UniProt	VAR_008384	P	187	S	NQO1_HUMAN	Polymorphism	1800566	D	P	186	S
3	UniProt	VAR_050220	Q	269	H	NQO1_HUMAN	Polymorphism	34447156	D	Q	268	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016170	R	139	W	NQO1_HUMAN	Polymorphism	1131341	C/D	R	138	W
2	UniProt	VAR_008384	P	187	S	NQO1_HUMAN	Polymorphism	1800566	C/D	P	186	S
3	UniProt	VAR_050220	Q	269	H	NQO1_HUMAN	Polymorphism	34447156	C/D	Q	268	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016170	R	139	W	NQO1_HUMAN	Polymorphism	1131341	A/B	R	138	W
2	UniProt	VAR_008384	P	187	S	NQO1_HUMAN	Polymorphism	1800566	A/B	P	186	S
3	UniProt	VAR_050220	Q	269	H	NQO1_HUMAN	Polymorphism	34447156	A/B	Q	268	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1QBG)

Asymmetric Unit (6, 23)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000320623	1a	ENSE00001900307	chr16:69760707-69760336	372	NQO1_HUMAN	1-3	3	3	A:2-2 - C:2-2 D:2-2	1 - 1 1
1.2	ENST00000320623	2	ENSE00001241523	chr16:69752437-69752273	165	NQO1_HUMAN	3-58	56	4	A:2-57 B:3-57 C:2-57 D:2-57	56 55 56 56
1.3	ENST00000320623	3	ENSE00001241515	chr16:69752156-69752026	131	NQO1_HUMAN	58-101	44	4	A:57-100 B:57-100 C:57-100 D:57-100	44 44 44 44
1.4	ENST00000320623	4	ENSE00001241509	chr16:69748980-69748867	114	NQO1_HUMAN	102-139	38	4	A:101-138 B:101-138 C:101-138 D:101-138	38 38 38 38
1.5	ENST00000320623	5	ENSE00001241503	chr16:69747032-69746931	102	NQO1_HUMAN	140-173	34	4	A:139-172 B:139-172 C:139-172 D:139-172	34 34 34 34
1.6c	ENST00000320623	6c	ENSE00001819797	chr16:69745184-69743304	1881	NQO1_HUMAN	174-274	101	4	A:173-273 B:173-273 C:173-273 D:173-273	101 101 101 101

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:272
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:272
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272  
           NQO1_HUMAN     3 GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbga_ A: NAD(P)H:quinone reductase                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1qbgA00 A:2-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------------------------------------------------Exon 1.3  PDB: A:57-100 UniProt: 58-101     Exon 1.4  PDB: A:101-138              Exon 1.5  PDB: A:139-172          Exon 1.6c  PDB: A:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: A:2-57 UniProt: 3-58                     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg A   2 VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271

Chain B from PDB  Type:PROTEIN  Length:271
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:271
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273 
           NQO1_HUMAN     4 RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbgb_ B: NAD(P)H:quinone reductase                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1qbgB00 B:3-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ------------------------------------------------------Exon 1.3  PDB: B:57-100 UniProt: 58-101     Exon 1.4  PDB: B:101-138              Exon 1.5  PDB: B:139-172          Exon 1.6c  PDB: B:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: B:3-57 UniProt: 3-58 [INCOMPLETE]       ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg B   3 RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272

Chain C from PDB  Type:PROTEIN  Length:272
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:272
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272  
           NQO1_HUMAN     3 GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbgc_ C: NAD(P)H:quinone reductase                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1qbgC00 C:2-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------------------------------------------------Exon 1.3  PDB: C:57-100 UniProt: 58-101     Exon 1.4  PDB: C:101-138              Exon 1.5  PDB: C:139-172          Exon 1.6c  PDB: C:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: C:2-57 UniProt: 3-58                     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg C   2 VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271

Chain D from PDB  Type:PROTEIN  Length:272
 aligned with NQO1_HUMAN | P15559 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:272
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272  
           NQO1_HUMAN     3 GRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 274
               SCOP domains d1qbgd_ D: NAD(P)H:quinone reductase                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1qbgD00 D:2-273  [code=3.40.50.360, no name defined]                                                                                                                                                                                                                             CATH domains
           Pfam domains (1) -Flavodoxin_2-1qbgD01 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -Flavodoxin_2-1qbgD02 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) -Flavodoxin_2-1qbgD03 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) -Flavodoxin_2-1qbgD04 D:3-211                                                                                                                                                                                     -------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author ..eeeeee......hhhhhhhhhhhhhhhhh..eeeeee..........hhhh...........hhhhhhhhhhhhh..hhhhhhhhhhhhhh..............hhhhhhhhhhhh..........hhhhh...............hhhhhh......hhhhhhhhhhh..hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhh...........hhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------S---------------------------------------------------------------------------------H----- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------------------------------------------------Exon 1.3  PDB: D:57-100 UniProt: 58-101     Exon 1.4  PDB: D:101-138              Exon 1.5  PDB: D:139-172          Exon 1.6c  PDB: D:173-273 UniProt: 174-274                                                            Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: D:2-57 UniProt: 3-58                     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1qbg D   2 VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK 273
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Flavodoxin-like (1057)

Superfamily: Flavoproteins (208)

Family: Quinone reductase (65)

Protein domain: NAD(P)H:quinone reductase (10)

Human (Homo sapiens) [TaxId: 9606] (8)

1a	d1qbga_	A:
1b	d1qbgb_	B:
1c	d1qbgc_	C:
1d	d1qbgd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.360, no name defined] (150)

Human (Homo sapiens) (27)

1a	1qbgB00	B:3-273
1b	1qbgA00	A:2-273
1c	1qbgC00	C:2-273
1d	1qbgD00	D:2-273

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Flavoprotein (71)

Family: Flavodoxin_2 (35)

Homo sapiens (Human) (22)

1a	Flavodoxin_2-1qbgD01	D:3-211
1b	Flavodoxin_2-1qbgD02	D:3-211
1c	Flavodoxin_2-1qbgD03	D:3-211
1d	Flavodoxin_2-1qbgD04	D:3-211

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (NQO1_HUMAN | P15559)

molecular function
	GO:0003955	NAD(P)H dehydrogenase (quinone) activity	Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a hydroquinone.
	GO:0004128	cytochrome-b5 reductase activity, acting on NAD(P)H	Catalysis of the reaction: NAD(P)H + H+ + 2 ferricytochrome b(5) = NAD(P)+ + 2 ferrocytochrome b(5).
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004784	superoxide dismutase activity	Catalysis of the reaction: 2 superoxide + 2 H+ = O2 + hydrogen peroxide.
biological process
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0043086	negative regulation of catalytic activity	Any process that stops or reduces the activity of an enzyme.
	GO:0006809	nitric oxide biosynthetic process	The chemical reactions and pathways resulting in the formation of nitric oxide, nitrogen monoxide (NO), a colorless gas only slightly soluble in water.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0043525	positive regulation of neuron apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
	GO:0006521	regulation of cellular amino acid metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving amino acids.
	GO:0019430	removal of superoxide radicals	Any process, acting at the cellular level, involved in removing superoxide radicals (O2-) from a cell or organism, e.g. by conversion to dioxygen (O2) and hydrogen peroxide (H2O2).
	GO:0032355	response to estradiol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0007584	response to nutrient	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0006979	response to oxidative stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0006801	superoxide metabolic process	The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.
	GO:0007271	synaptic transmission, cholinergic	The vesicular release of acetylcholine from a presynapse, across a chemical synapse, the subsequent activation of dopamine receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qbg)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qbg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NQO1_HUMAN \| P15559
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.6.99.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NQO1_HUMAN \| P15559
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1QBG)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 12)

PROSITE Motifs (0, 0)

Exons (6, 23)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (26, 26)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File