Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE BIFUNCTIONAL PRIMASE-HELICASE OF BACTERIOPHAGE T7
 
Authors :  E. A. Toth, Y. Li, M. R. Sawaya, Y. Cheng, T. Ellenberger
Date :  06 Aug 03  (Deposition) - 25 Nov 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.45
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G
Keywords :  Primase, Helicase, Dntpase, Dna Replication, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. A. Toth, Y. Li, M. R. Sawaya, Y. Cheng, T. Ellenberger
The Crystal Structure Of The Bifunctional Primase-Helicase Of Bacteriophage T7
Mol. Cell V. 12 1113 2003
PubMed-ID: 14636571  |  Reference-DOI: 10.1016/S1097-2765(03)00442-8

(-) Compounds

Molecule 1 - DNA PRIMASE/HELICASE
    ChainsA, B, C, D, E, F, G
    EC Number2.7.7.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Gene4
    MutationYES
    Organism ScientificENTEROBACTERIA PHAGE T7
    Organism Taxid10760

 Structural Features

(-) Chains, Units

  1234567
Asymmetric/Biological Unit ABCDEFG

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1Q57)

(-) Sites  (0, 0)

(no "Site" information available for 1Q57)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1Q57)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1Q57)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Q57)

(-) PROSITE Motifs  (2, 14)

Asymmetric/Biological Unit (2, 14)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TOPRIMPS50880 Toprim domain profile.PRIM_BPT7151-238
 
 
 
 
 
 
  7A:151-238
B:151-238
C:151-238
D:151-238
E:151-238
F:151-238
G:151-238
2SF4_HELICASEPS51199 Superfamily 4 helicase domain profile.PRIM_BPT7281-548
 
 
 
 
 
 
  7A:281-548
B:281-548
C:281-548
D:281-548
E:281-548
F:281-548
G:281-548

(-) Exons   (0, 0)

(no "Exon" information available for 1Q57)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:483
 aligned with PRIM_BPT7 | P03692 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:486
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
            PRIM_BPT7    64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
               SCOP domains d1q57a2 A:64-263 Primase fragment of primase-helicase protein                                                                                                                                           d1q57a1 A:264-549 Gene 4 protein (g4p, DNA primase), helicase domain                                                                                                                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1q57A02 A:262-549 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................hhhhhhhhheee........eeeeee.....eeeeeeee...eeeeee......eehhhhh..eeeeeee.hhhhhhhhh........eeee.....hhhhhhhhhhhhhhheeeeeee...hhhhhhhhhhhhhhhhhh.eee......hhhhhhh..hhhhhhhhhh.........eee...hhhhhhhhhhhh...........hhhhhhh......eeeeee..hhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...eeee...---hhhhhhhhhhhhhhh....eeeee............hhhhhhhhhhhhhhhhhhhhh.eeeeeee........................hhhhhhh.eeeeeee........eeeeeeeee......eeeeeeee......eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------TOPRIM  PDB: A:151-238 UniProt: 151-238                                                 ------------------------------------------SF4_HELICASE  PDB: A:281-548 UniProt: 281-548                                                                                                                                                                                                                               - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1q57 A  64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---ETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   |   403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
                                                                                                                                                                                                                                                                                                                                                                       397 401                                                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:483
 aligned with PRIM_BPT7 | P03692 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:486
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
            PRIM_BPT7    64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
               SCOP domains d1q57b2 B:64-263 Primase fragment of primase-helicase protein                                                                                                                                           d1q57b1 B:264-549 Gene 4 protein (g4p, DNA primase), helicase domain                                                                                                                                                                                                                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1q57B02 B:266-546 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                   --- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................hhhhhhhhheee........eeeeee.....eeeeeeee...eeeeee......eehhhhh..eeeeeee.hhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhheeeeeee...hhhhhhhhhhhhhhhhhh.eee......hhhhhhh..hhhhhhhhhh.........eee...hhhhhhhhhhhh...........hhhhhhh......eeeeee..hhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...eeee...---hhhhhhhhhhhhhhh....eeeee............hhhhhhhhhhhhhhhhhhhhh.eeeeeee........................hhhhhhh.eeeeeee........eeeeeeeee......eeeeeeee......eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------TOPRIM  PDB: B:151-238 UniProt: 151-238                                                 ------------------------------------------SF4_HELICASE  PDB: B:281-548 UniProt: 281-548                                                                                                                                                                                                                               - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1q57 B  64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---ETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   |   403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
                                                                                                                                                                                                                                                                                                                                                                       397 401                                                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:483
 aligned with PRIM_BPT7 | P03692 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:486
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
            PRIM_BPT7    64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
               SCOP domains d1q57c2 C:64-263 Primase fragment of primase-helicase protein                                                                                                                                           d1q57c1 C:264-549 Gene 4 protein (g4p, DNA primase), helicase domain                                                                                                                                                                                                                           SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1q57C02 C:264-549 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................hhhhhhhhheee........eeeeee.....eeeeeeee...eeeeee......eehhhhh..eeeeeee.hhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhheeeeeee...hhhhhhhhhhhhhhhhhh.eee......hhhhhhh..hhhhhhhhhh.........eee...hhhhhhhhhhhh...........hhhhhhh......eeeeee...hhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...eeee...---hhhhhhhhhhhhhhh....eeeee............hhhhhhhhhhhhhhhhhhhhh.eeeeeee........................hhhhhhh.eeeeeee........eeeeeeeee......eeeeeeee......eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------TOPRIM  PDB: C:151-238 UniProt: 151-238                                                 ------------------------------------------SF4_HELICASE  PDB: C:281-548 UniProt: 281-548                                                                                                                                                                                                                               - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1q57 C  64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---ETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   |   403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
                                                                                                                                                                                                                                                                                                                                                                       397 401                                                                                                                                                    

Chain D from PDB  Type:PROTEIN  Length:483
 aligned with PRIM_BPT7 | P03692 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:486
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
            PRIM_BPT7    64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
               SCOP domains d1q57d2 D:64-263 Primase fragment of primase-helicase protein                                                                                                                                           d1q57d1 D:264-549 Gene 4 protein (g4p, DNA primase), helicase domain                                                                                                                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1q57D02 D:293-549 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................hhhhhhhhheee........eeeeee.....eeeeeeee...eeeeee......eehhhhh..eeeeeee.hhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhheeeeeee...hhhhhhhhhhhhhhhhhh.eee......hhhhhhh..hhhhhhhhhh.........eee...hhhhhhhhhhhh...........hhhhhhh......eeeeee...hhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...eeee...---.hhhhhhhhhhhhhh....eeee.............hhhhhhhhhhhhhhhhhhhhh.eeeeeee........................hhhhhhh.eeeeee.........eeeeeeeee......eeeeeeee......eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------TOPRIM  PDB: D:151-238 UniProt: 151-238                                                 ------------------------------------------SF4_HELICASE  PDB: D:281-548 UniProt: 281-548                                                                                                                                                                                                                               - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1q57 D  64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---ETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   |   403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
                                                                                                                                                                                                                                                                                                                                                                       397 401                                                                                                                                                    

Chain E from PDB  Type:PROTEIN  Length:483
 aligned with PRIM_BPT7 | P03692 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:486
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
            PRIM_BPT7    64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
               SCOP domains d1q57e2 E:64-263 Primase fragment of primase-helicase protein                                                                                                                                           d1q57e1 E:264-549 Gene 4 protein (g4p, DNA primase), helicase domain                                                                                                                                                                                                                           SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1q57E02 E:264-549 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................hhhhhhhhheee........eeeeee.....eeeeeeee...eeeeee......eehhhhh..eeeeeee.hhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhheeeeeee...hhhhhhhhhhhhhhhhhh.eee......hhhhhhh..hhhhhhhhhh.........eee...hhhhhhhhhhhh...........hhhhhhh......eeeeee..hhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...eeee...---hhhhhhhhhhhhhhh....eeee.............hhhhhhhhhhhhhhhhhhhhh.eeeeeee........................hhhhhhh.eeeeeee........eeeeeeeee......eeeeeeee......eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------TOPRIM  PDB: E:151-238 UniProt: 151-238                                                 ------------------------------------------SF4_HELICASE  PDB: E:281-548 UniProt: 281-548                                                                                                                                                                                                                               - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1q57 E  64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---ETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   |   403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
                                                                                                                                                                                                                                                                                                                                                                       397 401                                                                                                                                                    

Chain F from PDB  Type:PROTEIN  Length:483
 aligned with PRIM_BPT7 | P03692 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:486
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
            PRIM_BPT7    64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
               SCOP domains d1q57f2 F:64-263 Primase fragment of primase-helicase protein                                                                                                                                           d1q57f1 F:264-549 Gene 4 protein (g4p, DNA primase), helicase domain                                                                                                                                                                                                                           SCOP domains
               CATH domains -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1q57F02 F:267-549 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................hhhhhhhhheee........eeeeee.....eeeeeeee...eeeeee......eehhhhh..eeeeeee.hhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhheeeeeee...hhhhhhhhhhhhhhhhhh.eee......hhhhhhh..hhhhhhhhhh.........eee...hhhhhhhhhhhh...........hhhhhhh......eeeeee...hhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...eeee...---hhhhhhhhhhhhhhh....eeeee............hhhhhhhhhhhhhhhhhhhhh.eeeeeee........................hhhhhhh.eeeeeee........eeeeeeeee......eeeeeeee......eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------TOPRIM  PDB: F:151-238 UniProt: 151-238                                                 ------------------------------------------SF4_HELICASE  PDB: F:281-548 UniProt: 281-548                                                                                                                                                                                                                               - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1q57 F  64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---ETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   |   403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
                                                                                                                                                                                                                                                                                                                                                                       397 401                                                                                                                                                    

Chain G from PDB  Type:PROTEIN  Length:483
 aligned with PRIM_BPT7 | P03692 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:486
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
            PRIM_BPT7    64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
               SCOP domains d1q57g2 G:64-263 Primase fragment of primase-helicase protein                                                                                                                                           d1q57g1 G:264-549 Gene 4 protein (g4p, DNA primase), helicase domain                                                                                                                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------1q57G02 G:137-262  [code=3.40.1360.10, no name defined]                                                                       1q57G03 G:263-549 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                          CATH domains
           Pfam domains (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DnaB_C-1q57G01 G:287-525                                                                                                                                                                                                                       ------------------------ Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DnaB_C-1q57G02 G:287-525                                                                                                                                                                                                                       ------------------------ Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DnaB_C-1q57G03 G:287-525                                                                                                                                                                                                                       ------------------------ Pfam domains (3)
           Pfam domains (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DnaB_C-1q57G04 G:287-525                                                                                                                                                                                                                       ------------------------ Pfam domains (4)
           Pfam domains (5) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DnaB_C-1q57G05 G:287-525                                                                                                                                                                                                                       ------------------------ Pfam domains (5)
           Pfam domains (6) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DnaB_C-1q57G06 G:287-525                                                                                                                                                                                                                       ------------------------ Pfam domains (6)
           Pfam domains (7) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DnaB_C-1q57G07 G:287-525                                                                                                                                                                                                                       ------------------------ Pfam domains (7)
         Sec.struct. author .......................hhhhhhhhheee........eeeeee.....eeeeeeee...eeeeee......eehhhhh..eeeeeee.hhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhheeeeeee...hhhhhhhhhhhhhhhhhh.eee......hhhhhhh..hhhhhhhhhh.........eee...hhhhhhhhhhhh...........hhhhhhh......eeeeee...hhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...eeee...---hhhhhhhhhhhhhhh....eeeee............hhhhhhhhhhhhhhhhhhhhh.eeeeeee........................hhhhhhh.eeeeee.........eeeeeeeee......eeeeeeee......eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------TOPRIM  PDB: G:151-238 UniProt: 151-238                                                 ------------------------------------------SF4_HELICASE  PDB: G:281-548 UniProt: 281-548                                                                                                                                                                                                                               - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1q57 G  64 MTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---ETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG 549
                                    73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393   |   403       413       423       433       443       453       463       473       483       493       503       513       523       533       543      
                                                                                                                                                                                                                                                                                                                                                                       397 401                                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 14)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 8)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 7)

Asymmetric/Biological Unit

(-) Gene Ontology  (16, 16)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G   (PRIM_BPT7 | P03692)
molecular function
    GO:0043139    5'-3' DNA helicase activity    Catalysis of the unwinding of the DNA helix in the direction 5' to 3'.
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003678    DNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA helix.
    GO:0003896    DNA primase activity    Catalysis of the synthesis of a short RNA primer on a DNA template, providing a free 3'-OH that can be extended by DNA-directed DNA polymerases.
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0032508    DNA duplex unwinding    The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006269    DNA replication, synthesis of RNA primer    The synthesis of a short RNA polymer, usually 4-15 nucleotides long, using one strand of unwound DNA as a template; the RNA then serves as a primer from which DNA polymerases extend synthesis.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1q57)
 
  Sites
(no "Sites" information available for 1q57)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1q57)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1q57
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PRIM_BPT7 | P03692
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PRIM_BPT7 | P03692
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PRIM_BPT7 | P036921cr0 1cr1 1cr2 1cr4 1e0j 1e0k 1nui 5ikn

(-) Related Entries Specified in the PDB File

1cr0 MONOMERIC HELICASE FRAGMENT FROM BACTERIOPHAGE T7
1cr1 MONOMERIC HELICASE FRAGMENT FROM BACTERIOPHAGE T7,DTTP COMPLEX
1cr2 MONOMERIC HELICASE FRAGMENT FROM BACTERIOPHAGE T7,DATP COMPLEX
1cr4 MONOMERIC HELICASE FRAGMENT FROM BACTERIOPHAGE T7,DTDP COMPLEX
1e0j HEXAMERIC HELICASE FRAGMENT FROM BACTERIOPHAGE T7, ANPNP COMPLEX
1e0k HEXAMERIC HELICASE FRAGMENT FROM BACTERIOPHAGE T7
1nui PRIMASE FRAGMENT FROM BACTERIOPHAGE T7