Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SUGAR-PHOSPHATE ALDOLASE FROM THERMOTOGA MARITIMA
 
Authors :  J. Osipiuk, M. E. Cuff, O. Korolev, T. Skarina, A. Savchenko, A. Edwards A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  28 Jun 03  (Deposition) - 23 Sep 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (4x)
Keywords :  Structural Genomics, Sugar-Phosphate Aldolase, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Osipiuk, M. E. Cuff, O. Korolev, T. Skarina, A. Savchenko, A. Edwards, A. Joachimiak
Crystal Structure Of Sugar-Phosphate Aldolase From Thermotoga Maritima.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SUGAR-PHOSPHATE ALDOLASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: TM1072
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (1x): A
Biological Unit 2 (4x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric Unit (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 32)
No.NameCountTypeFull Name
1MSE32Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1PVT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PVT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PVT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PVT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PVT)

(-) Exons   (0, 0)

(no "Exon" information available for 1PVT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:232
 aligned with Q9X0G1_THEMA | Q9X0G1 from UniProtKB/TrEMBL  Length:236

    Alignment length:232
                              1                                                                                                                                                                                                                                     
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228  
         Q9X0G1_THEMA     - --MRETIREIQKVAYWLAIKGLSEANAGNISVRLDERPEGYEVKSVNEYGFDYDGPEMYLLITATGSRMREVYEDDSKICLLHVLPGKHYEILHGNGKPTSEFPTHLMIHAKFKEMNPEKKAIVHTHPLNLLTLMNLEEFQELLPKMMKIHPEVLIFFPQGISVVEFEKPGSVELGLKTVEKSEGKDAVLWDKHGVVAFGKDVAEAYDRVEILEKAAEILLRVLSLGRNPTG 230
               SCOP domains d1pvta_ A: Putative sugar-phosphate aldolase                                                                                                                                                                                             SCOP domains
               CATH domains 1pvtA00 A:2X-230 L-fuculose-1-phosphate Aldolase                                                                                                                                                                                         CATH domains
               Pfam domains -------Aldolase_II-1pvtA01 A:6-219                                                                                                                                                                                           ----------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh.......eeeeeee..........eeeeeeeee....eeeeee....hhhhhh.hhh.eeeeee..eeeeeeee.......hhhhhhhhhhhhhhh.....eeeee.hhhhhhhh.......hhhhhh..hhhhhhhh....eee......hhhhhhhhhhhh....eeee....eeeee.hhhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pvt A  2X GHmRETIREIQKVAYWLAIKGLSEANAGNISVRLDERPEGYEVKSVNEYGFDYDGPEmYLLITATGSRmREVYEDDSKICLLHVLPGKHYEILHGNGKPTSEFPTHLmIHAKFKEmNPEKKAIVHTHPLNLLTLmNLEEFQELLPKmmKIHPEVLIFFPQGISVVEFEKPGSVELGLKTVEKSEGKDAVLWDKHGVVAFGKDVAEAYDRVEILEKAAEILLRVLSLGRNPTG 230
                            |||      8        18        28        38        48       |58        68        78        88        98       108     | 118       128    |  138      |148       158       168       178       188       198       208       218       228  
                            |||                                                     56-MSE     67-MSE                                106-MSE 114-MSE            133-MSE     145-MSE                                                                                 
                           2X||                                                                                                                                              146-MSE                                                                                
                            1X|                                                                                                                                                                                                                                     
                              1-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: Aldolase_II] (19)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q9X0G1_THEMA | Q9X0G1)
molecular function
    GO:0016832    aldehyde-lyase activity    Catalysis of the cleavage of a C-C bond in a molecule containing a hydroxyl group and a carbonyl group to form two smaller molecules, each being an aldehyde or a ketone.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0008994    rhamnulose-1-phosphate aldolase activity    Catalysis of the reaction: L-rhamnulose 1-phosphate = glycerone phosphate + (S)-lactaldehyde.
biological process
    GO:0019323    pentose catabolic process    The chemical reactions and pathways resulting in the breakdown of a pentose, any monosaccharide with a chain of five carbon atoms in the molecule.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1pvt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pvt)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pvt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9X0G1_THEMA | Q9X0G1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9X0G1_THEMA | Q9X0G1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1PVT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PVT)