1PRE - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   PROAEROLYSIN

Authors :   M. W. Parker, J. T. Buckley, J. P. M. Postma, A. D. Tucker, D. Tsernoglou

Date :   15 Sep 95 (Deposition) - 14 Oct 96 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym./Biol. Unit : A,B

Keywords :   Toxin (Hemolytic Polypeptide), Signal (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. W. Parker, J. T. Buckley, J. P. Postma, A. D. Tucker, K. Leonard, F. Pattus, D. Tsernoglou
Structure Of The Aeromonas Toxin Proaerolysin In Its Water-Soluble And Membrane-Channel States.
Nature V. 367 292 1994
PubMed-ID: 7510043 | Reference-DOI: 10.1038/367292A0
(for further references see the PDB file header)

Molecule 1 - PROAEROLYSIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	AEROMONAS SALMONICIDA
	Expression System Plasmid	:	PRK2013
	Expression System Taxid	:	645
	Organism Scientific	:	AEROMONAS HYDROPHILA
	Organism Taxid	:	644

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1PRE)

(no "Site" information available for 1PRE)

Asymmetric/Biological Unit

No.	Residues
1	A:19	-	A:75
2	A:159	-	A:164
3	B:19	-	B:75
4	B:159	-	B:164

(no "Cis Peptide Bond" information available for 1PRE)

(no "SAP(SNP)/Variant" information available for 1PRE)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	AEROLYSIN	PS00274	Aerolysin type toxins signature.	AERA_AERHY	246-255	2	A:223-232 B:223-232

(no "Exon" information available for 1PRE)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:449
 aligned with AERA_AERHY | P09167 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:469
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484         
           AERA_AERHY    25 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPAANQ 493
               SCOP domains d1prea1 A:2-84 Proaerolysin, N-terminal domain                                     d1prea2 A:85-470 (Pro)aerolysin, pore-forming lobe                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1preA01 A:2-90 Pertussis Toxin, subunit B, domain 1                                      1preA02 A:91-176,A:311-397 Proaerolysin, chain A, domain 2                            1preA03 A:177-310,A:398-470 Pro   aerolysin, chain A, domain 3                                                                        1preA02 A:91-176,A:311-397 Proaerolysin, chain A, domain 2                             1preA03 A:177-310,A:398-4                 70 Proaerolysin, chain A, domai CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee..........eee..hhhhhh.hhhhhhh.....eee....eeee.hhh...eee.....eeeee.............eee....hhhhhhhhh......hhhhhhhhhh.................eeeee....eeeee...............eeeee..eeeeehhh..........eeeeeeeeeeeee.---....eeeeeeeeeeeeeee.....hhh...........................hhh..eeeeeeeeeeee.......eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee................eeeeeeee.....hhh.hhhhhh....hhh.....hhhhhhhh.hhhhhhhhhhhh..eeeeeeeeeeeeeeee..eee......-----------------..eee....hhhhhh......eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEROLYSIN ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pre A   2 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVND---PQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPL-----------------GLRLEIPLDAQELSGLGFNNVSLSVTPAANQ 470
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     | 211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421|        -       441       451       461         
                                                                                                                                                                                                                                       207 211                                                                                                                                                                                                                422               440

Chain B from PDB  Type:PROTEIN  Length:451
 aligned with AERA_AERHY | P09167 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:467
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       
           AERA_AERHY    25 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPAA 491
               SCOP domains d1preb1 B:2-84 Proaerolysin, N-terminal domain                                     d1preb2 B:85-468 (Pro)aerolysin, pore-forming lobe                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1preB01 B:2-90 Pertussis Toxin, subunit B, domain 1                                      1preB02 B:91-176,B:311-397 Proaerolysin, chain A, domain 2                            1preB03 B:177-310,B:398-467 Proaerolysin, chain A, domain 3                                                                           1preB02 B:91-176,B:311-397 Proaerolysin, chain A, domain 2                             1preB03 B:177-310,B:398-467                 Proaerolysin, chain A, dom- CATH domains
           Pfam domains (1) APT-1preB03 B:2-83                                                                ------------Aerolysin-1preB01 B:96-454                                                                                                                                                                                                                                                                                                                                             -------------- Pfam domains (1)
           Pfam domains (2) APT-1preB04 B:2-83                                                                ------------Aerolysin-1preB02 B:96-454                                                                                                                                                                                                                                                                                                                                             -------------- Pfam domains (2)
         Sec.struct. author ....hhh.eee..........eee..hhhhhhhhhhhhhh.....eeee...eeee.hhh...eee.....eeeee.............eee....hhhhhhhhh......hhhhhhhhhh.................eeeeee..eeeeee...............eeeee..eeeeehhh........eeeeeeeeeeeeeee........eeeeeeeeeeeeeee.....hhhh..........................hhh..eeeeeeeeeeee.......eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee................eeeeeeee.....hhh.hhhhhh............hhhhhhhh.hhhhhhhhhhh...eeeeeeeeeeeeeeee..eee........----------------.eee....hhhhhhh.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEROLYSIN -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pre B   2 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAA----------------LRLEIPLDAQELSGLGFNNVSLSVTPAA 468
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421  |      -       441       451       461       
                                                                                                                                                                                                                                                                                                                                                                                                                                                                424              441

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Proaerolysin; Chain A, domain 2 (7)

Homologous Superfamily: Proaerolysin, chain A, domain 2 (7)

Aeromonas hydrophila. Organism_taxid: 644. (2)

1a	1preA02	A:91-176,A:311-397
1b	1preB02	B:91-176,B:311-397

Architecture: Roll (3276)

Topology: Pertussis Toxin; Chain B, domain 1 (10)

Homologous Superfamily: Pertussis Toxin, subunit B, domain 1 (10)

Aeromonas hydrophila. Organism_taxid: 644. (2)

2a	1preA01	A:2-90
2b	1preB01	B:2-90

Class: Mainly Beta (13760)

Architecture: Beta Complex (381)

Topology: Proaerolysin; Chain A, domain 3 (10)

Homologous Superfamily: Proaerolysin, chain A, domain 3 (10)

Aeromonas hydrophila. Organism_taxid: 644. (2)

3a	1preA03	A:177-310,A:398-470
3b	1preB03	B:177-310,B:398-467

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Aerolisin_ETX (6)

Family: Aerolysin (2)

Aeromonas hydrophila (2)

1a	Aerolysin-1preB01	B:96-454
1b	Aerolysin-1preB02	B:96-454

Clan: C_Lectin (98)

Family: APT (4)

Aeromonas hydrophila (2)

2a	APT-1preB03	B:2-83
2b	APT-1preB04	B:2-83

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (AERA_AERHY | P09167)

biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pre)

	Sites
(no "Sites" information available for 1pre)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pre)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1pre
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AERA_AERHY \| P09167
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AERA_AERHY \| P09167
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AERA_AERHY \| P09167	:	1z52 3c0m 3c0n 3c0o 3g4n 3g4o 5jzh 5jzt 5jzw

(no "Related Entries Specified in the PDB File" available for 1PRE)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (3, 6)

Pfam Domains (2, 4)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File