Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PROAEROLYSIN
 
Authors :  M. W. Parker, J. T. Buckley, J. P. M. Postma, A. D. Tucker, D. Tsernoglou
Date :  15 Sep 95  (Deposition) - 14 Oct 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Toxin (Hemolytic Polypeptide), Signal (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. W. Parker, J. T. Buckley, J. P. Postma, A. D. Tucker, K. Leonard, F. Pattus, D. Tsernoglou
Structure Of The Aeromonas Toxin Proaerolysin In Its Water-Soluble And Membrane-Channel States.
Nature V. 367 292 1994
PubMed-ID: 7510043  |  Reference-DOI: 10.1038/367292A0
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROAEROLYSIN
    ChainsA, B
    EngineeredYES
    Expression SystemAEROMONAS SALMONICIDA
    Expression System PlasmidPRK2013
    Expression System Taxid645
    Organism ScientificAEROMONAS HYDROPHILA
    Organism Taxid644

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1PRE)

(-) Sites  (0, 0)

(no "Site" information available for 1PRE)

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:19 -A:75
2A:159 -A:164
3B:19 -B:75
4B:159 -B:164

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PRE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PRE)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1AEROLYSINPS00274 Aerolysin type toxins signature.AERA_AERHY246-255
 
  2A:223-232
B:223-232

(-) Exons   (0, 0)

(no "Exon" information available for 1PRE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:449
 aligned with AERA_AERHY | P09167 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:469
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484         
           AERA_AERHY    25 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPAANQ 493
               SCOP domains d1prea1 A:2-84 Proaerolysin, N-terminal domain                                     d1prea2 A:85-470 (Pro)aerolysin, pore-forming lobe                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1preA01 A:2-90 Pertussis Toxin, subunit B, domain 1                                      1preA02 A:91-176,A:311-397 Proaerolysin, chain A, domain 2                            1preA03 A:177-310,A:398-470 Pro   aerolysin, chain A, domain 3                                                                        1preA02 A:91-176,A:311-397 Proaerolysin, chain A, domain 2                             1preA03 A:177-310,A:398-4                 70 Proaerolysin, chain A, domai CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee..........eee..hhhhhh.hhhhhhh.....eee....eeee.hhh...eee.....eeeee.............eee....hhhhhhhhh......hhhhhhhhhh.................eeeee....eeeee...............eeeee..eeeeehhh..........eeeeeeeeeeeee.---....eeeeeeeeeeeeeee.....hhh...........................hhh..eeeeeeeeeeee.......eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee................eeeeeeee.....hhh.hhhhhh....hhh.....hhhhhhhh.hhhhhhhhhhhh..eeeeeeeeeeeeeeee..eee......-----------------..eee....hhhhhh......eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEROLYSIN ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pre A   2 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVND---PQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPL-----------------GLRLEIPLDAQELSGLGFNNVSLSVTPAANQ 470
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     | 211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421|        -       441       451       461         
                                                                                                                                                                                                                                       207 211                                                                                                                                                                                                                422               440                              

Chain B from PDB  Type:PROTEIN  Length:451
 aligned with AERA_AERHY | P09167 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:467
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       
           AERA_AERHY    25 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPAA 491
               SCOP domains d1preb1 B:2-84 Proaerolysin, N-terminal domain                                     d1preb2 B:85-468 (Pro)aerolysin, pore-forming lobe                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1preB01 B:2-90 Pertussis Toxin, subunit B, domain 1                                      1preB02 B:91-176,B:311-397 Proaerolysin, chain A, domain 2                            1preB03 B:177-310,B:398-467 Proaerolysin, chain A, domain 3                                                                           1preB02 B:91-176,B:311-397 Proaerolysin, chain A, domain 2                             1preB03 B:177-310,B:398-467                 Proaerolysin, chain A, dom- CATH domains
           Pfam domains (1) APT-1preB03 B:2-83                                                                ------------Aerolysin-1preB01 B:96-454                                                                                                                                                                                                                                                                                                                                             -------------- Pfam domains (1)
           Pfam domains (2) APT-1preB04 B:2-83                                                                ------------Aerolysin-1preB02 B:96-454                                                                                                                                                                                                                                                                                                                                             -------------- Pfam domains (2)
         Sec.struct. author ....hhh.eee..........eee..hhhhhhhhhhhhhh.....eeee...eeee.hhh...eee.....eeeee.............eee....hhhhhhhhh......hhhhhhhhhh.................eeeeee..eeeeee...............eeeee..eeeeehhh........eeeeeeeeeeeeeee........eeeeeeeeeeeeeee.....hhhh..........................hhh..eeeeeeeeeeee.......eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee................eeeeeeee.....hhh.hhhhhh............hhhhhhhh.hhhhhhhhhhh...eeeeeeeeeeeeeeee..eee........----------------.eee....hhhhhhh.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEROLYSIN -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pre B   2 EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAA----------------LRLEIPLDAQELSGLGFNNVSLSVTPAA 468
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421  |      -       441       451       461       
                                                                                                                                                                                                                                                                                                                                                                                                                                                                424              441                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: C_Lectin (98)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (AERA_AERHY | P09167)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pre)
 
  Sites
(no "Sites" information available for 1pre)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pre)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pre
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AERA_AERHY | P09167
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AERA_AERHY | P09167
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AERA_AERHY | P091671z52 3c0m 3c0n 3c0o 3g4n 3g4o 5jzh 5jzt 5jzw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PRE)