|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1PE4) |
Sites (0, 0)| (no "Site" information available for 1PE4) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1PE4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1PE4) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1PE4) |
Exons (0, 0)| (no "Exon" information available for 1PE4) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:67 aligned with SCX12_CENNO | P63019 from UniProtKB/Swiss-Prot Length:67 Alignment length:67 10 20 30 40 50 60 SCX12_CENNO 1 RDGYPLASNGCKFGCSGLGENNPTCNHVCEKKAGSDYGYCYAWTCYCEHVAEGTVLWGDSGTGPCRS 67 SCOP domains d1pe4a_ A: Scorpion toxin SCOP domains CATH domains 1pe4A00 A:1-67 [code=3.30.30.10, no name defined] CATH domains Pfam domains Toxin_3-1pe4A01 A:1-54 ------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1pe4 A 1 RDGYPLASNGCKFGCSGLGENNPTCNHVCEKKAGSDYGYCYAWTCYCEHVAEGTVLWGDSGTGPCRS 67 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (SCX12_CENNO | P63019)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|