Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ECHICETIN FROM THE VENOM OF INDIAN SAW-SCALED VIPER (ECHIS CARINATUS) AT 2.4 RESOLUTION
 
Authors :  J. Jasti, M. Paramasivam, A. Srinivasan, T. P. Singh
Date :  08 Apr 03  (Deposition) - 30 Dec 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Platelet Aggregation, Echicetin, Dimer, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Jasti, M. Paramasivam, A. Srinivasan, T. P. Singh
Crystal Structure Of Echicetin From Echis Carinatus (Indian Saw-Scaled Viper) At 2. 4A Resolution.
J. Mol. Biol. V. 335 167 2004
PubMed-ID: 14659748  |  Reference-DOI: 10.1016/J.JMB.2003.10.048
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ECHICETIN A-CHAIN
    ChainsA
    Organism CommonSAW-SCALED VIPER
    Organism ScientificECHIS CARINATUS
    Organism Taxid40353
    SecretionVENOM
    SynonymECHICETIN ALPHA-SUBUNIT
 
Molecule 2 - ECHICETIN B-CHAIN
    ChainsB
    FragmentRESIDUES 1-123
    Organism CommonSAW-SCALED VIPER
    Organism ScientificECHIS CARINATUS
    Organism Taxid40353
    SecretionVENOM
    SynonymECHICETIN BETA-SUBUNIT

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1OZ7)

(-) Sites  (0, 0)

(no "Site" information available for 1OZ7)

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:2 -A:13
2A:30 -A:125
3A:78 -B:75
4A:100 -A:117
5B:2 -B:13
6B:30 -B:119
7B:96 -B:111

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1OZ7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OZ7)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1C_TYPE_LECTIN_2PS50041 C-type lectin domain profile.SLA_ECHCA13-130  1A:9-126
SLB_ECHCA32-143  1B:9-120

(-) Exons   (0, 0)

(no "Exon" information available for 1OZ7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:131
 aligned with SLA_ECHCA | Q7T248 from UniProtKB/Swiss-Prot  Length:135

    Alignment length:131
                                    14        24        34        44        54        64        74        84        94       104       114       124       134 
            SLA_ECHCA     5 MCPPGWSSNGVYCYMLFKEPKTWDEAEKFCNKQGKDGHLLSIESKKEEILVDIVVSENIGKMYKIWTGLSERSKEQHCSSRWSDGSFFRSYEIAIRYSECFVLEKQSVFRTWVATPCENTFPFMCKYPVPR 135
               SCOP domains d1oz7a_ A: Snake coagglutinin alpha chain                                                                                           SCOP domains
               CATH domains 1oz7A00 A:1-131 Mannose-Binding Protein A, subunit A                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeeeeeeeeehhhhhhhhhhhhh...ee....hhhhhhhhhhhhhhhh....eeeeeeee..hhhhh.....................eeeee.hhh...eeee.....eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------C_TYPE_LECTIN_2  PDB: A:9-126 UniProt: 13-130                                                                         ----- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1oz7 A   1 MCPPGWSSNGVYCYMLFKEPKTWDEAEKFCNKQGKDGHLLSIESKKEEILVDIVVSENIGKMYKIWTGLSERSKEQHCSSRWSDGSFFRSYEIAIRYSECFVLEKQSVFRTWVATPCENTFPFMCKYPVPR 131
                                    10        20        30        40        50        60        70        80        90       100       110       120       130 

Chain B from PDB  Type:PROTEIN  Length:123
 aligned with SLB_ECHCA | Q7T247 from UniProtKB/Swiss-Prot  Length:146

    Alignment length:123
                                    33        43        53        63        73        83        93       103       113       123       133       143   
            SLB_ECHCA    24 NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPMLKNDLVWIGLTDYWRDCNWEWSDGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFVCKCPA 146
               SCOP domains d1oz7b_ B: Snake coagglutinin beta chain                                                                                    SCOP domains
               CATH domains 1oz7B00 B:1-123 Mannose-Binding Protein A, subunit A                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeeeeeeeeehhhhhhhhhhhhh...ee......hhhhhhhhh........eeeeeee...hhh.eee................eeeee....eeeee.....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------C_TYPE_LECTIN_2  PDB: B:9-120 UniProt: 32-143                                                                   --- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 1oz7 B   1 NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPMLKNDLVWIGLTDYWRDCNWEWSDGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFVCKCPA 123
                                    10        20        30        40        50        60        70        80        90       100       110       120   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1OZ7)

(-) Gene Ontology  (1, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (SLA_ECHCA | Q7T248)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B   (SLB_ECHCA | Q7T247)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1oz7)
 
  Sites
(no "Sites" information available for 1oz7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1oz7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1oz7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SLA_ECHCA | Q7T248
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SLB_ECHCA | Q7T247
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SLA_ECHCA | Q7T248
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SLB_ECHCA | Q7T247
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1OZ7)

(-) Related Entries Specified in the PDB File

1bj3 CRYSTAL STRUCTURE OF COAGULATION FACTOR IX-BINDING PROTEIN (IX-BP) FROM VENOM OF HABU SNAKE WITH A HETERODIMER OF C- TYPE LECTIN DOMAINS
1iod CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN THE COAGULATION FACTOR X BINDING PROTEIN FROM SNAKE VENOM AND THE GLA DOMAIN OF FACTOR X
1ixx CRYSTAL STRUCTURE OF COAGULATION FACTORS IX/X-BINDING PROTEIN (IX/X-BP) FROM VENOM OF HABU SNAKE WITH A HETERODIMER OF C-TYPE LECTIN DOMAINS