Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TERNARY COMPLEX BETWEEN TRIMETHYLAMINE DEHYDROGENASE AND ELECTRON TRANSFERRING FLAVOPROTEIN
 
Authors :  D. Leys, J. Basran, F. Talfournier, M. J. Sutcliffe, N. S. Scrutton
Date :  11 Dec 02  (Deposition) - 06 Feb 03  (Release) - 18 Sep 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.70
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Electron Transport/Complex, Protein Complex, Electron Transfer, Dehydrogenase, Electron Transport, Flavoprotein, Oxido-Reductase, Iron-Sulfur, Fmn (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Leys, J. Basran, F. Talfournier, M. J. Sutcliffe, N. S. Scrutton
Extensive Conformational Sampling In A Ternary Electron Transfer Complex.
Nat. Struct. Biol. V. 10 219 2003
PubMed-ID: 12567183  |  Reference-DOI: 10.1038/NSB894

(-) Compounds

Molecule 1 - TRIMETHYLAMINE DEHYDROGENASE
    ChainsA, B
    EC Number1.5.99.7
    Organism ScientificMETHYLOPHILUS METHYLOTROPHUS
    Organism Taxid17
    Other DetailsLINK BETWEEN FMN AND RESIDUE 30
    SynonymTMADH
 
Molecule 2 - ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    ChainsC, E
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificMETHYLOPHILUS METHYLOTROPHUS
    Organism Taxid17
    SynonymBETA-ETF, ELECTRON TRANSFER FLAVOPROTEIN SMALL SUBUNIT, ETFSS
 
Molecule 3 - ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT
    ChainsD, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificMETHYLOPHILUS METHYLOTROPHUS
    Organism Taxid17
    SynonymALPHA-ETF, ELECTRON TRANSFER FLAVOPROTEIN LARGE SUBUNIT, ETFLS

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric/Biological Unit (4, 8)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2AMP2Ligand/IonADENOSINE MONOPHOSPHATE
3FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
4SF42Ligand/IonIRON/SULFUR CLUSTER

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:27 , PRO A:28 , HIS A:29 , CYS A:30 , TYR A:60 , GLU A:103 , TYR A:169 , HIS A:172 , ARG A:222 , TRP A:264 , ASP A:267 , ALA A:268 , VAL A:297 , ARG A:299 , CYS A:320 , ALA A:321 , ARG A:322 , PRO A:323 , ILE A:352BINDING SITE FOR RESIDUE FMN A1730
2AC2SOFTWAREVAL A:395 , GLY A:396 , GLY A:398 , PRO A:399 , SER A:400 , ASP A:419 , THR A:420 , GLY A:426 , HIS A:427 , PRO A:469 , MET A:470 , ALA A:486 , THR A:487 , GLY A:488 , GLY A:673 , ASP A:674BINDING SITE FOR RESIDUE ADP A1731
3AC3SOFTWAREARG A:322 , ILE A:325 , CYS A:345 , ILE A:346 , GLY A:347 , CYS A:348 , ASN A:349 , VAL A:350 , CYS A:351 , CYS A:364 , THR A:365BINDING SITE FOR RESIDUE SF4 A1732
4AC4SOFTWAREVAL B:27 , PRO B:28 , HIS B:29 , CYS B:30 , GLU B:59 , TYR B:60 , GLU B:103 , TYR B:169 , HIS B:172 , ARG B:222 , TRP B:264 , ASP B:267 , VAL B:297 , ARG B:299 , CYS B:320 , ALA B:321 , ARG B:322 , PRO B:323 , CYS B:351 , ILE B:352BINDING SITE FOR RESIDUE FMN B1730
5AC5SOFTWAREVAL B:395 , GLY B:396 , GLY B:398 , PRO B:399 , SER B:400 , ASP B:419 , THR B:420 , GLY B:426 , HIS B:427 , MET B:470 , ALA B:486 , THR B:487 , GLY B:488 , GLY B:673 , ASP B:674BINDING SITE FOR RESIDUE ADP B1731
6AC6SOFTWAREARG B:322 , ILE B:325 , CYS B:345 , ILE B:346 , GLY B:347 , CYS B:348 , ASN B:349 , VAL B:350 , CYS B:351 , CYS B:364 , THR B:365BINDING SITE FOR RESIDUE SF4 B1732
7AC7SOFTWAREALA C:6 , VAL C:7 , ASN C:36 , ASP C:39 , VAL C:62 , VAL C:64 , VAL C:100 , ALA C:118 , GLY C:119 , GLN C:121 , SER C:122 , TYR C:127 , ALA C:128 , SER C:129 , THR C:130BINDING SITE FOR RESIDUE AMP C1236
8AC8SOFTWAREALA E:6 , VAL E:7 , LYS E:8 , ASN E:36 , ASP E:39 , VAL E:64 , VAL E:100 , ALA E:118 , GLY E:119 , GLN E:121 , SER E:122 , ALA E:126 , TYR E:127 , ALA E:128 , SER E:129 , THR E:130BINDING SITE FOR RESIDUE AMP E1237

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1O95)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Thr A:70 -His A:71
2Thr B:70 -His B:71
3Glu C:15 -Asp C:16
4Cys C:176 -Pro C:177
5Glu E:15 -Asp E:16
6Cys E:176 -Pro E:177

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1O95)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ETF_BETAPS01065 Electron transfer flavoprotein beta-subunit signature.ETFB_METME160-181
 
  2C:160-181
E:160-181

(-) Exons   (0, 0)

(no "Exon" information available for 1O95)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:729
 aligned with DHTM_METME | P16099 from UniProtKB/Swiss-Prot  Length:730

    Alignment length:729
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721         
           DHTM_METME     2 ARDPKHDILFEPIQIGPKTLRNRFYQVPHCIGAGSDKPGFQSAHRSVKAEGGWAALNTEYCSINPESDDTHRLSARIWDEGDVRNLKAMTDEVHKYGALAGVELWYGGAHAPNMESRATPRGPSQYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTDTAEKIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLALGQKPMTADDVLQYGADKVIIATGARWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIEFDSLVLVTGRHSECTLWNELKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVAREIEEANPQIAIPYKRETIAWGTPHMPGGNFKIEYKV 730
               SCOP domains d1o95a1 A:1-340 Trimethylamine dehydrogenase, N-terminal domain                                                                                                                                                                                                                                                                                     d1o95a3 A:341-489,A:646-729 Trimethylamine dehydrogenase, middle domain                                                                              d1o95a2 A:490-645 Trimethylamine dehydrogenase, C-terminal domain                                                                                           d1o95a3 A:341-489,A:646-729 Trimethylamine dehydrogenase, middle domain              SCOP domains
               CATH domains 1o95A01 A:1-384 Aldolase class I                                                                                                                                                                                                                                                                                                                                                                1o95A02 A:385-491,A:644-704 NAD(P)-binding Rossmann-like Domain                                            1o95A03 A:492-643  [code=3.50.50.60, no name defined]                                                                                                   1o95A02 A:385-491,A:644-704                                  ------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh.eee..eee...eee..........hhhhhhhhhhhhhhh...eee...ee............ee..hhhhhhhhhhhhhhhhh...eeeeeee.hhhhh.........ee..............ee.hhhhhhhhhhhhhhhhhhhhhhh..eeeeee...hhhhhhhh............hhhhhhhhhhhhhhhhhhhhh...eeeeeeeee............hhhhhhhhhh....eeeeee....hhhhh...........hhhhhhhhhhhh...ee......hhhhhhhhhhh.....eeehhhhhhh.hhhhhhhh.hhhhh......hhhhhhhhhh................................eeeee..hhhhhhhhhhhhhh..eeeeee.......hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhh....eeee...eee......................eehhhhhhhh......eeeeee....hhhhhhhhhhhhh..eeeeee....hhhhhh..hhhhhhhhhhhh..eeee.eeeeeee..eeeeee........................eeee..eeeee..eee.hhhhhhhhhh..hhhhhh..eeee.hhhh...hhhhhhhhhhhhhhh................................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o95 A   1 ARDPKHDILFEPIQIGPKTLRNRFYQVPHCIGAGSDKPGFQSAHRSVKAEGGWAALNTEYCSINPESDDTHRLSARIWDEGDVRNLKAMTDEVHKYGALAGVELWYGGAHAPNMESRATPRGPSQYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTDTAEKIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLALGQKPMTADDVLQYGADKVIIATGARWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIEFDSLVLVTGRHSECTLWNELKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVAREIEEANPQIAIPYKRETIAWGTPHMPGGNFKIEYKV 729
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720         

Chain B from PDB  Type:PROTEIN  Length:729
 aligned with DHTM_METME | P16099 from UniProtKB/Swiss-Prot  Length:730

    Alignment length:729
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721         
           DHTM_METME     2 ARDPKHDILFEPIQIGPKTLRNRFYQVPHCIGAGSDKPGFQSAHRSVKAEGGWAALNTEYCSINPESDDTHRLSARIWDEGDVRNLKAMTDEVHKYGALAGVELWYGGAHAPNMESRATPRGPSQYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTDTAEKIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLALGQKPMTADDVLQYGADKVIIATGARWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIEFDSLVLVTGRHSECTLWNELKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVAREIEEANPQIAIPYKRETIAWGTPHMPGGNFKIEYKV 730
               SCOP domains d1o95b1 B:1-340 Trimethylamine dehydrogenase, N-terminal domain                                                                                                                                                                                                                                                                                     d1o95b3 B:341-489,B:646-729 Trimethylamine dehydrogenase, middle domain                                                                              d1o95b2 B:490-645 Trimethylamine dehydrogenase, C-terminal domain                                                                                           d1o95b3 B:341-489,B:646-729 Trimethylamine dehydrogenase, middle domain              SCOP domains
               CATH domains 1o95B01 B:1-384 Aldolase class I                                                                                                                                                                                                                                                                                                                                                                1o95B02 B:385-491,B:644-704 NAD(P)-binding Rossmann-like Domain                                            1o95B03 B:492-643  [code=3.50.50.60, no name defined]                                                                                                   1o95B02 B:385-491,B:644-704                                  ------------------------- CATH domains
           Pfam domains (1) -------Oxidored_FMN-1o95B03 B:8-341                                                                                                                                                                                                                                                                                                                  -------------------------------------------------Pyr_redox_2-1o95B01 B:391-534                                                                                                                   --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------Oxidored_FMN-1o95B04 B:8-341                                                                                                                                                                                                                                                                                                                  -------------------------------------------------Pyr_redox_2-1o95B02 B:391-534                                                                                                                   --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhh.eee..eee...eee..........hhhhhhhhhhhhhhh...eeeeeeee............ee..hhhhhhhhhhhhhhhhh...eeeeeee.hhhhh.........ee..............ee.hhhhhhhhhhhhhhhhhhhhhhh..eeeeee...hhhhhhhh............hhhhhhhhhhhhhhhhhhhhh...eeeeeeeee...........hhhhhhhhhhh....eeeeee....hhhhh...........hhhhhhh........ee......hhhhhhhhhhh.....eeehhhhhhh.hhhhhhhh.hhhhh......hhhhhhhhhh................................eeeee..hhhhhhhhhhhhhhh.eeeee........hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...eee......hhhhhhh....eeee...eee......................eehhhhhhhh......eeeeee....hhhhhhhhhhhhh..eeeeee....hhhhhhh.hhhhhhhhhhhh.eeee..eeeeeee..eeeeee........................eeee..eeeee..eee.hhhhhhhhhhhhhhhhhh..eeee.hhhh...hhhhhhhhhhhhhhh................................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o95 B   1 ARDPKHDILFEPIQIGPKTLRNRFYQVPHCIGAGSDKPGFQSAHRSVKAEGGWAALNTEYCSINPESDDTHRLSARIWDEGDVRNLKAMTDEVHKYGALAGVELWYGGAHAPNMESRATPRGPSQYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTDTAEKIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLALGQKPMTADDVLQYGADKVIIATGARWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYMHFTLEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIEFDSLVLVTGRHSECTLWNELKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVAREIEEANPQIAIPYKRETIAWGTPHMPGGNFKIEYKV 729
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720         

Chain C from PDB  Type:PROTEIN  Length:233
 aligned with ETFB_METME | P53570 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:235
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     
           ETFB_METME     1 MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVVVVSVGPDRVDESLRKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHAAVVADLQYKPGDNKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIP 235
               SCOP domains d1o95c_ C: Small, be ta subunit of electron transfer f lavoprotein ETFP                                                                                                                                                                     SCOP domains
               CATH domains 1o95C00 C:1-235 Tyro syl-Transfer RNA Synthetase , sub unit E, domain 1                                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..eeeee.......-.........eeeee..hhhhhhhhhhhhhhhh.-..eeeeeee....hhhhhhhhhhhh..eeeeeehhhhh....hhhhhhhhhhhhhhh..eeeee.........hhhhhhhhhhh..eeeeeeeee......eeeeeee.....eeeeeee...eeee..........hhhhhhhhhh...eeee.hhhh.hhhhhhhhhh..eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------ETF_BETA              ------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o95 C   1 MKILVAVKQTAALEEDFEIR-DGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSD-DVEVVVVSVGPDRVDESLRKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHAAVVADLQYKPGDNKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIP 235
                                    10        20 |      30        40        50   | |  60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     
                                              20 |                              54 |                                                                                                                                                                                   
                                                22                                56                                                                                                                                                                                   

Chain D from PDB  Type:PROTEIN  Length:189
 aligned with ETFA_METME | P53571 from UniProtKB/Swiss-Prot  Length:321

    Alignment length:189
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181         
           ETFA_METME     2 SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYV 190
               SCOP domains d1o95d_ D: Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain                                                                                                     SCOP domains
               CATH domains 1o95D00 D:1-189 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..ee..ee.hhhhhhhhhhhhh......eeeeeee..hhhhhhhhhh.....eeeeee......hhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhh.eeeeee.eeeee..eeeeeeee....eeeeee......eeeee..............eeeeee.......eeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o95 D   1 SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYV 189
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180         

Chain E from PDB  Type:PROTEIN  Length:236
 aligned with ETFB_METME | P53570 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:236
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230      
           ETFB_METME     1 MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVVVVSVGPDRVDESLRKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHAAVVADLQYKPGDNKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPE 236
               SCOP domains d1o95e_ E: Small, beta subunit of electron transfer flavoprotein ETFP                                                                                                                                                                        SCOP domains
               CATH domains 1o95E00 E:1-236 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                        CATH domains
           Pfam domains (1) ----------------------ETF-1o95E01 E:23-189                                                                                                                                                   ----------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------------------ETF-1o95E02 E:23-189                                                                                                                                                   ----------------------------------------------- Pfam domains (2)
         Sec.struct. author .eeeeee.eeeee.............hhh.eeeee..hhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhhhhhh..eeeeeehhhhh....hhhhhhhhhhhhhhh..eeeee.........hhhhhhhhhh...eeeeeeeee......eeeeeee.hhh.eeeeeee...eeee..........hhhhhhhhhh...eeee.hhhh.hhhhhhhhhh..eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------ETF_BETA              ------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o95 E   1 MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVVVVSVGPDRVDESLRKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHAAVVADLQYKPGDNKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPE 236
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230      

Chain F from PDB  Type:PROTEIN  Length:189
 aligned with ETFA_METME | P53571 from UniProtKB/Swiss-Prot  Length:321

    Alignment length:189
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181         
           ETFA_METME     2 SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYV 190
               SCOP domains d1o95f_ F: Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain                                                                                                     SCOP domains
               CATH domains 1o95F00 F:1-189 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                         CATH domains
           Pfam domains (1) -ETF-1o95F01 F:2-162                                                                                                                                              --------------------------- Pfam domains (1)
           Pfam domains (2) -ETF-1o95F02 F:2-162                                                                                                                                              --------------------------- Pfam domains (2)
         Sec.struct. author .eeeee..ee..ee.hhhhhhhhhhhhhh.....eeeeeee..hhhhhh.........eeeeee......hhhhhhhhhhhhhhhhh..eeeee.hhhhhh..hhhhhh...eeeeee.eeeee..eeeeeeee....eeeeee......eeeee..............eeeeee............ee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o95 F   1 SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYV 189
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (5, 10)

Asymmetric/Biological Unit

(-) CATH Domains  (4, 10)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 8)

Asymmetric/Biological Unit
(-)
Clan: HUP (230)

(-) Gene Ontology  (10, 13)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (DHTM_METME | P16099)
molecular function
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0050470    trimethylamine dehydrogenase activity    Catalysis of the reaction: trimethylamine + H2O + electron-transferring flavoprotein = dimethylamine + formaldehyde + reduced electron-transferring flavoprotein.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain C,E   (ETFB_METME | P53570)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain D,F   (ETFA_METME | P53571)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    AMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Cys C:176 - Pro C:177   [ RasMol ]  
    Cys E:176 - Pro E:177   [ RasMol ]  
    Glu C:15 - Asp C:16   [ RasMol ]  
    Glu E:15 - Asp E:16   [ RasMol ]  
    Thr A:70 - His A:71   [ RasMol ]  
    Thr B:70 - His B:71   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1o95
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DHTM_METME | P16099
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ETFA_METME | P53571
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ETFB_METME | P53570
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.5.99.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DHTM_METME | P16099
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ETFA_METME | P53571
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ETFB_METME | P53570
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DHTM_METME | P160991djn 1djq 1o94 2tmd
        ETFA_METME | P535711e11 1o94 1o96 1o97 3clr 3cls 3clt 3clu
        ETFB_METME | P535701e11 1o94 1o96 1o97 3clr 3cls 3clt 3clu

(-) Related Entries Specified in the PDB File

1djn STRUCTURAL AND BIOCHEMICAL CHARACTERIZATION OF RECOMBINANT WILD TYPE TRIMETHYLAMINE DEHYDROGENASE FROM METHYLOPHILUS METHYLOTROPHUS ( SP. W3A1)
1djq STRUCTURAL AND BIOCHEMICAL CHARACTERIZATION OF RECOMBINANT C30A MUTANT OF TRIMETHYLAMINE DEHYDROGENASE FROM METHYLOPHILUS METHYLOTROPHUS ( SP. W3A1)
1e11 MODEL STRUCTURE OF ELECTRON TRANSFERRING FLAVOPROTEIN FROM METHYLOPHILUS METHYLOTROPUS ( CA COORDINATES)
1o94 TERNARY COMPLEX BETWEEN TRIMETHYLAMINE DEHYDROGENASE AND ELECTRON TRANSFERRING FLAVOPROTEIN
1o96 STRUCTURE OF ELECTRON TRANSFERRING FLAVOPROTEIN FOR METHYLOPHILUS METHYLOTROPHUS.
1o97 STRUCTURE OF ELECTRON TRANSFERRING FLAVOPROTEIN FROM METHYLOPHILUS METHYLOTROPHUS, RECOGNITION LOOP REMOVED BY LIMITED PROTEOLYSIS
2tmd TRIMETHYLAMINE DEHYDROGENASE