1O7P - JenaLib

Asymmetric Unit (23, 23)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_NDOB_PSEPU_001 *	N	4	K	NDOB_PSEPU	---	---	A	N	4	K
02	UniProt	VAR_NDOB_PSEPU_002 *	S	12	F	NDOB_PSEPU	---	---	A	S	12	F
03	UniProt	VAR_NDOB_PSEPU_003 *	S	15	T	NDOB_PSEPU	---	---	A	S	15	T
04	UniProt	VAR_NDOB_PSEPU_004 *	K	32	R	NDOB_PSEPU	---	---	A	K	32	R
05	UniProt	VAR_NDOB_PSEPU_005 *	A	50	S	NDOB_PSEPU	---	---	A	A	50	S
06	UniProt	VAR_NDOB_PSEPU_006 *	N	70	S	NDOB_PSEPU	---	---	A	N	70	S
07	UniProt	VAR_NDOB_PSEPU_007 *	D	122	E	NDOB_PSEPU	---	---	A	D	122	E
08	UniProt	VAR_NDOB_PSEPU_008 *	M	173	I	NDOB_PSEPU	---	---	A	M	173	I
09	UniProt	VAR_NDOB_PSEPU_009 *	S	225	A	NDOB_PSEPU	---	---	A	S	225	A
10	UniProt	VAR_NDOB_PSEPU_010 *	S	225	C	NDOB_PSEPU	---	---	A	S	225	C
11	UniProt	VAR_NDOB_PSEPU_011 *	A	232	V	NDOB_PSEPU	---	---	A	A	232	V
12	UniProt	VAR_NDOB_PSEPU_012 *	A	275	S	NDOB_PSEPU	---	---	A	A	275	S
13	UniProt	VAR_NDOB_PSEPU_013 *	E	391	K	NDOB_PSEPU	---	---	A	E	391	K
14	UniProt	VAR_NDOB_PSEPU_014 *	Q	421	R	NDOB_PSEPU	---	---	A	Q	421	R
15	UniProt	VAR_NDOB_PSEPU_015 *	H	434	D	NDOB_PSEPU	---	---	A	H	434	D
16	UniProt	VAR_NDOC_PSEPU_001 *	E	17	Q	NDOC_PSEPU	---	---	B	E	517	Q
17	UniProt	VAR_NDOC_PSEPU_002 *	I	19	F	NDOC_PSEPU	---	---	B	I	519	F
18	UniProt	VAR_NDOC_PSEPU_003 *	S	28	A	NDOC_PSEPU	---	---	B	S	528	A
19	UniProt	VAR_NDOC_PSEPU_004 *	V	99	I	NDOC_PSEPU	---	---	B	V	599	I
20	UniProt	VAR_NDOC_PSEPU_005 *	G	109	S	NDOC_PSEPU	---	---	B	G	609	S
21	UniProt	VAR_NDOC_PSEPU_006 *	M	127	R	NDOC_PSEPU	---	---	B	M	627	R
22	UniProt	VAR_NDOC_PSEPU_007 *	N	130	D	NDOC_PSEPU	---	---	B	N	630	D
23	UniProt	VAR_NDOC_PSEPU_008 *	K	132	E	NDOC_PSEPU	---	---	B	K	632	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (23, 69)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_NDOB_PSEPU_001 *	N	4	K	NDOB_PSEPU	---	---	A	N	4	K
02	UniProt	VAR_NDOB_PSEPU_002 *	S	12	F	NDOB_PSEPU	---	---	A	S	12	F
03	UniProt	VAR_NDOB_PSEPU_003 *	S	15	T	NDOB_PSEPU	---	---	A	S	15	T
04	UniProt	VAR_NDOB_PSEPU_004 *	K	32	R	NDOB_PSEPU	---	---	A	K	32	R
05	UniProt	VAR_NDOB_PSEPU_005 *	A	50	S	NDOB_PSEPU	---	---	A	A	50	S
06	UniProt	VAR_NDOB_PSEPU_006 *	N	70	S	NDOB_PSEPU	---	---	A	N	70	S
07	UniProt	VAR_NDOB_PSEPU_007 *	D	122	E	NDOB_PSEPU	---	---	A	D	122	E
08	UniProt	VAR_NDOB_PSEPU_008 *	M	173	I	NDOB_PSEPU	---	---	A	M	173	I
09	UniProt	VAR_NDOB_PSEPU_009 *	S	225	A	NDOB_PSEPU	---	---	A	S	225	A
10	UniProt	VAR_NDOB_PSEPU_010 *	S	225	C	NDOB_PSEPU	---	---	A	S	225	C
11	UniProt	VAR_NDOB_PSEPU_011 *	A	232	V	NDOB_PSEPU	---	---	A	A	232	V
12	UniProt	VAR_NDOB_PSEPU_012 *	A	275	S	NDOB_PSEPU	---	---	A	A	275	S
13	UniProt	VAR_NDOB_PSEPU_013 *	E	391	K	NDOB_PSEPU	---	---	A	E	391	K
14	UniProt	VAR_NDOB_PSEPU_014 *	Q	421	R	NDOB_PSEPU	---	---	A	Q	421	R
15	UniProt	VAR_NDOB_PSEPU_015 *	H	434	D	NDOB_PSEPU	---	---	A	H	434	D
16	UniProt	VAR_NDOC_PSEPU_001 *	E	17	Q	NDOC_PSEPU	---	---	B	E	517	Q
17	UniProt	VAR_NDOC_PSEPU_002 *	I	19	F	NDOC_PSEPU	---	---	B	I	519	F
18	UniProt	VAR_NDOC_PSEPU_003 *	S	28	A	NDOC_PSEPU	---	---	B	S	528	A
19	UniProt	VAR_NDOC_PSEPU_004 *	V	99	I	NDOC_PSEPU	---	---	B	V	599	I
20	UniProt	VAR_NDOC_PSEPU_005 *	G	109	S	NDOC_PSEPU	---	---	B	G	609	S
21	UniProt	VAR_NDOC_PSEPU_006 *	M	127	R	NDOC_PSEPU	---	---	B	M	627	R
22	UniProt	VAR_NDOC_PSEPU_007 *	N	130	D	NDOC_PSEPU	---	---	B	N	630	D
23	UniProt	VAR_NDOC_PSEPU_008 *	K	132	E	NDOC_PSEPU	---	---	B	K	632	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (2, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:447
 aligned with NDOB_PSEPU | P0A110 from UniProtKB/Swiss-Prot  Length:449

    Alignment length:447
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       
           NDOB_PSEPU     1 MNYNNKILVSESGLSQKHLIHGDEELFQHELKTIFARNWLFLTHDSLIPAPGDYVTAKMGIDEVIVSRQNDGSIRAFLNVCRHRGKTLVSVEAGNAKGFVCSYHGWGFGSNGELQSVPFEKDLYGESLNKKCLGLKEVARVESFHGFIYGCFDQEAPPLMDYLGDAAWYLEPMFKHSGGLELVGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGESIFSSLAGNAALPPEGAGLQMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGDVRARIYRSHLNCTVFPNNSMLTCSGVFKVWNPIDANTTEVWTYAIVEKDMPEDLKRRLADSVQRTFGPAGFWESDDNDNMETASQNGKKYQSRDSDLLSNLGFGEDVYGDAVYPGVVGKSAIGETSYRGFYRAYQAHVSSSNWAEFEHASSTWHTELTKTT 447
               SCOP domains d1o7pa1 A:1-154 Naphthalene 1,2-dioxygenase alpha subunit, N-domain                                                                                       d1o7pa2 A:155-447 Naphthalene 1,2-dioxygenase alpha subunit, C-domain                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1o7pA01 A:1-35,A:165-447           1o7pA02 A:36-164 'Rieske'-like iron-sulphur domains                                                                              1o7pA01 A:1-35,A:165-447 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------Rieske-1o7pA02 A:38-139                                                                               -------------------Ring_hydroxyl_A-1o7pA01 A:159-426                                                                                                                                                                                                                                           --------------------- Pfam domains
         Sec.struct. author .........hhhh.eee.hhhhhhhhhhhhhhhh.....eeeee.hhh....eeeeeee..eeeeeee.....eeeee..............eee..eee......eee....eee..hhhhhhh...hhhhh......eeeee..eeeee......hhhhhhhhhhhhhhhhhh....eeeeeeeeeeee...hhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhh.......eeeee.....eeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee...eeee....eeeeeeeee..eeeeeeeeeee...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..eee........ee.......eee.....hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---K-------F--T----------------R-----------------S-------------------S---------------------------------------------------E--------------------------------------------------I---------------------------------------------------A------V------------------------------------------S-------------------------------------------------------------------------------------------------------------------K-----------------------------R------------D------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (1) --------------------------------------RIESKE  PDB: A:39-123 UniProt: 39-123                                                ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------RING_HYDROXYL_ALPHA     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o7p A   1 MNYNNKILVSESGLSQKHLIHGDEELFQHELKTIFARNWLFLTHDSLIPAPGDYVTAKMGIDEVIVSRQNDGSIRAFLNVCRHRGKTLVSVEAGNAKGFVCSYHGWGFGSNGELQSVPFEKDLYGESLNKKCLGLKEVARVESFHGFIYGCFDQEAPPLMDYLGDAAWYLEPMFKHSGGLELVGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGESIFSSLAGNAALPPEGAGLQMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGDVRARIYRSHLNCTVFPNNSMLTCSGVFKVWNPIDANTTEVWTYAIVEKDMPEDLKRRLADSVQRTFGPAGFWESDDNDNMETASQNGKKYQSRDSDLLSNLGFGEDVYGDAVYPGVVGKSAIGETSYRGFYRAYQAHVSSSNWAEFEHASSTWHTELTKTT 447
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440

Chain A from PDB  Type:PROTEIN  Length:447
 aligned with NDOB_PSEU8 | P0A111 from UniProtKB/Swiss-Prot  Length:449

    Alignment length:447
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       
           NDOB_PSEU8     1 MNYNNKILVSESGLSQKHLIHGDEELFQHELKTIFARNWLFLTHDSLIPAPGDYVTAKMGIDEVIVSRQNDGSIRAFLNVCRHRGKTLVSVEAGNAKGFVCSYHGWGFGSNGELQSVPFEKDLYGESLNKKCLGLKEVARVESFHGFIYGCFDQEAPPLMDYLGDAAWYLEPMFKHSGGLELVGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGESIFSSLAGNAALPPEGAGLQMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGDVRARIYRSHLNCTVFPNNSMLTCSGVFKVWNPIDANTTEVWTYAIVEKDMPEDLKRRLADSVQRTFGPAGFWESDDNDNMETASQNGKKYQSRDSDLLSNLGFGEDVYGDAVYPGVVGKSAIGETSYRGFYRAYQAHVSSSNWAEFEHASSTWHTELTKTT 447
               SCOP domains d1o7pa1 A:1-154 Naphthalene 1,2-dioxygenase alpha subunit, N-domain                                                                                       d1o7pa2 A:155-447 Naphthalene 1,2-dioxygenase alpha subunit, C-domain                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1o7pA01 A:1-35,A:165-447           1o7pA02 A:36-164 'Rieske'-like iron-sulphur domains                                                                              1o7pA01 A:1-35,A:165-447 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------Rieske-1o7pA02 A:38-139                                                                               -------------------Ring_hydroxyl_A-1o7pA01 A:159-426                                                                                                                                                                                                                                           --------------------- Pfam domains
         Sec.struct. author .........hhhh.eee.hhhhhhhhhhhhhhhh.....eeeee.hhh....eeeeeee..eeeeeee.....eeeee..............eee..eee......eee....eee..hhhhhhh...hhhhh......eeeee..eeeee......hhhhhhhhhhhhhhhhhh....eeeeeeeeeeee...hhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhh.......eeeee.....eeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee...eeee....eeeeeeeee..eeeeeeeeeee...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..eee........ee.......eee.....hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---K-------F--T----------------R-----------------S-------------------S---------------------------------------------------E--------------------------------------------------I---------------------------------------------------A------V------------------------------------------S-------------------------------------------------------------------------------------------------------------------K-----------------------------R------------D------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (2) --------------------------------------RIESKE  PDB: A:39-123 UniProt: 39-123                                                ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------RING_HYDROXYL_ALPHA     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o7p A   1 MNYNNKILVSESGLSQKHLIHGDEELFQHELKTIFARNWLFLTHDSLIPAPGDYVTAKMGIDEVIVSRQNDGSIRAFLNVCRHRGKTLVSVEAGNAKGFVCSYHGWGFGSNGELQSVPFEKDLYGESLNKKCLGLKEVARVESFHGFIYGCFDQEAPPLMDYLGDAAWYLEPMFKHSGGLELVGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGESIFSSLAGNAALPPEGAGLQMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGDVRARIYRSHLNCTVFPNNSMLTCSGVFKVWNPIDANTTEVWTYAIVEKDMPEDLKRRLADSVQRTFGPAGFWESDDNDNMETASQNGKKYQSRDSDLLSNLGFGEDVYGDAVYPGVVGKSAIGETSYRGFYRAYQAHVSSSNWAEFEHASSTWHTELTKTT 447
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440

Chain B from PDB  Type:PROTEIN  Length:193
 aligned with NDOC_PSEPU | P0A112 from UniProtKB/Swiss-Prot  Length:194

    Alignment length:193
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191   
           NDOC_PSEPU     2 MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL 194
               SCOP domains d1o7pb_ B: Naphthalene 1,2-dioxygenase beta subunit                                                                                                                                               SCOP domains
               CATH domains 1o7pB00 B:502-694  [code=3.10.450.50, no name defined]                                                                                                                                            CATH domains
               Pfam domains --------------------------------------Ring_hydroxyl_B-1o7pB01 B:540-688                                                                                                                    ------ Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhheeeeeeeeeeee..............eeeeeeehhhhhhhhhhhhhh..hhhhh...eeeeeeeeeeeee......eeeeeeeeeeeeee...eeeeeeeeeeeeeee.hhh.eeeeeeeee............... Sec.struct. author
                 SAPs(SNPs) ---------------Q-F--------A----------------------------------------------------------------------I---------S-----------------R--D-E-------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o7p B 502 MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL 694
                                   511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691

Chain B from PDB  Type:PROTEIN  Length:193
 aligned with NDOC_PSEU8 | P0A113 from UniProtKB/Swiss-Prot  Length:194

    Alignment length:193
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191   
           NDOC_PSEU8     2 MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL 194
               SCOP domains d1o7pb_ B: Naphthalene 1,2-dioxygenase beta subunit                                                                                                                                               SCOP domains
               CATH domains 1o7pB00 B:502-694  [code=3.10.450.50, no name defined]                                                                                                                                            CATH domains
               Pfam domains --------------------------------------Ring_hydroxyl_B-1o7pB01 B:540-688                                                                                                                    ------ Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhheeeeeeeeeeee..............eeeeeeehhhhhhhhhhhhhh..hhhhh...eeeeeeeeeeeee......eeeeeeeeeeeeee...eeeeeeeeeeeeeee.hhh.eeeeeeeee............... Sec.struct. author
                 SAPs(SNPs) ---------------Q-F--------A----------------------------------------------------------------------I---------S-----------------R--D-E-------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o7p B 502 MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL 694
                                   511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (3, 3)

Pfam Domains (3, 3)

Gene Ontology (14, 40)

Asymmetric Unit(hide GO term definitions)

Chain A (NDOB_PSEPU | P0A110)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0018625	naphthalene 1,2-dioxygenase activity	Catalysis of the reaction: naphthalene + NADH + H+ + O2 = (1R,2S)-1,2-dihydronaphthalene-1,2-diol + NAD+.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
	GO:0016708	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of two atoms of oxygen into one donor	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from NADH or NADPH and one other donor, and two atoms of oxygen are incorporated into one donor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0019439	aromatic compound catabolic process	The chemical reactions and pathways resulting in the breakdown of aromatic compounds, any substance containing an aromatic carbon ring.
	GO:0006725	cellular aromatic compound metabolic process	The chemical reactions and pathways involving aromatic compounds, any organic compound characterized by one or more planar rings, each of which contains conjugated double bonds and delocalized pi electrons, as carried out by individual cells.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain A (NDOB_PSEU8 | P0A111)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0018625	naphthalene 1,2-dioxygenase activity	Catalysis of the reaction: naphthalene + NADH + H+ + O2 = (1R,2S)-1,2-dihydronaphthalene-1,2-diol + NAD+.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
	GO:0016708	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of two atoms of oxygen into one donor	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from NADH or NADPH and one other donor, and two atoms of oxygen are incorporated into one donor.
biological process
	GO:0019439	aromatic compound catabolic process	The chemical reactions and pathways resulting in the breakdown of aromatic compounds, any substance containing an aromatic carbon ring.
	GO:0006725	cellular aromatic compound metabolic process	The chemical reactions and pathways involving aromatic compounds, any organic compound characterized by one or more planar rings, each of which contains conjugated double bonds and delocalized pi electrons, as carried out by individual cells.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain B (NDOC_PSEU8 | P0A113)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0018625	naphthalene 1,2-dioxygenase activity	Catalysis of the reaction: naphthalene + NADH + H+ + O2 = (1R,2S)-1,2-dihydronaphthalene-1,2-diol + NAD+.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0019439	aromatic compound catabolic process	The chemical reactions and pathways resulting in the breakdown of aromatic compounds, any substance containing an aromatic carbon ring.
	GO:0006725	cellular aromatic compound metabolic process	The chemical reactions and pathways involving aromatic compounds, any organic compound characterized by one or more planar rings, each of which contains conjugated double bonds and delocalized pi electrons, as carried out by individual cells.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain B (NDOC_PSEPU | P0A112)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0018625	naphthalene 1,2-dioxygenase activity	Catalysis of the reaction: naphthalene + NADH + H+ + O2 = (1R,2S)-1,2-dihydronaphthalene-1,2-diol + NAD+.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0019439	aromatic compound catabolic process	The chemical reactions and pathways resulting in the breakdown of aromatic compounds, any substance containing an aromatic carbon ring.
	GO:0006725	cellular aromatic compound metabolic process	The chemical reactions and pathways involving aromatic compounds, any organic compound characterized by one or more planar rings, each of which contains conjugated double bonds and delocalized pi electrons, as carried out by individual cells.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 12)

Sites (12, 12)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (23, 23)

PROSITE Motifs (2, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (3, 3)

Pfam Domains (3, 3)

Gene Ontology (14, 40)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File