|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1NZ8) |
Sites (0, 0)| (no "Site" information available for 1NZ8) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1NZ8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1NZ8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1NZ8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1NZ8) |
Exons (0, 0)| (no "Exon" information available for 1NZ8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:119 aligned with NUSG_THET8 | P35872 from UniProtKB/Swiss-Prot Length:184 Alignment length:119 11 21 31 41 51 61 71 81 91 101 111 NUSG_THET8 2 SIEWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEVVELREGGKKEVVRKKLFPGYLFIQMDLGDEEEPNEAWEVVRGTPGITGFVGAGMRPVPLSPDEVRHILEVSGLLG 120 SCOP domains d1nz8a_ A: N-utilization substance G protein NusG, N-terminal domain SCOP domains CATH domains 1nz8A00 A:2-120 [code=3.30.70.940, no name defined] CATH domains Pfam domains -NusG-1nz8A01 A:3-107 ------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 1nz8 A 2 SIEWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEVVELREGGKKEVVRKKLFPGYLFIQMDLGDEEEPNEAWEVVRGTPGITGFVGAGMRPVPLSPDEVRHILEVSGLLG 120 11 21 31 41 51 61 71 81 91 101 111
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (NUSG_THET8 | P35872)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|