Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  INTEGRIN ALPHA M I DOMAIN
 
Authors :  C. J. Mccleverty, R. C. Liddington
Date :  26 Nov 02  (Deposition) - 20 May 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Rossmann Fold, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. J. Mccleverty, R. C. Liddington
Engineered Allosteric Mutants Of The Integrin Alphambeta2 I Domain: Structural And Functional Studies
Biochem. J. V. 372 121 2003
PubMed-ID: 12611591  |  Reference-DOI: 10.1042/BJ20021273
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INTEGRIN ALPHA-M
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-2T
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentALPHA M I DOMAIN
    GeneITGAM OR CR3A OR CD11B
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCELL SURFACE GLYCOPROTEIN MAC-1 ALPHA SUBUNIT, CR- 3 ALPHA CHAIN, CD11B, LEUKOCYTE ADHESION RECEPTOR MO1, NEUTROPHIL ADHERENCE RECEPTOR

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1NA5)

(-) Sites  (0, 0)

(no "Site" information available for 1NA5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NA5)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Lys A:290 -Pro A:291

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NA5)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FG_GAPPS51470 FG-GAP repeat profile.ITAM_HUMAN18-75
76-135
339-390
443-503
391-442
506-564
569-629
  1-
-
A:321-324
-
-
-
-
2VWFAPS50234 VWFA domain profile.ITAM_HUMAN150-328  1A:134-312

(-) Exons   (5, 5)

Asymmetric/Biological Unit (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002874971ENSE00001716458chr16:31271288-31271413126ITAM_HUMAN1-10100--
1.2ENST000002874972ENSE00001304825chr16:31273013-31273118106ITAM_HUMAN10-45360--
1.3ENST000002874973ENSE00001802514chr16:31276716-31276819104ITAM_HUMAN45-80360--
1.4ENST000002874974ENSE00001675692chr16:31277132-3127720271ITAM_HUMAN80-103240--
1.5ENST000002874975ENSE00001028855chr16:31277351-31277468118ITAM_HUMAN104-143400--
1.6ENST000002874976ENSE00001028857chr16:31282275-31282405131ITAM_HUMAN143-186441A:130-17041
1.7ENST000002874977ENSE00001191919chr16:31283168-31283313146ITAM_HUMAN187-235491A:171-21949
1.8ENST000002874978ENSE00001028975chr16:31284686-31284839154ITAM_HUMAN235-286521A:219-27052
1.9ENST000002874979ENSE00001028959chr16:31286870-31287020151ITAM_HUMAN287-337511A:271-32050
1.10ENST0000028749710ENSE00001028953chr16:31287992-3128806574ITAM_HUMAN337-361251A:321-3244
1.11ENST0000028749711ENSE00001028971chr16:31288241-31288370130ITAM_HUMAN362-405440--
1.12ENST0000028749712ENSE00001191904chr16:31289288-31289430143ITAM_HUMAN405-452480--
1.13ENST0000028749713ENSE00001691688chr16:31308835-31308975141ITAM_HUMAN453-499470--
1.14ENST0000028749714ENSE00001709132chr16:31309066-31309275210ITAM_HUMAN500-569700--
1.15ENST0000028749715ENSE00001028860chr16:31332562-31332692131ITAM_HUMAN570-613440--
1.16ENST0000028749716ENSE00001191889chr16:31332785-31332948164ITAM_HUMAN613-668560--
1.17ENST0000028749717ENSE00001191883chr16:31335720-31335874155ITAM_HUMAN668-719520--
1.18ENST0000028749718ENSE00001028868chr16:31335972-31336103132ITAM_HUMAN720-763440--
1.19ENST0000028749719ENSE00001028854chr16:31336279-3133635274ITAM_HUMAN764-788250--
1.20ENST0000028749720ENSE00001028859chr16:31336584-31336725142ITAM_HUMAN788-835480--
1.21ENST0000028749721ENSE00001028853chr16:31336821-31336943123ITAM_HUMAN836-876410--
1.22ENST0000028749722ENSE00001242102chr16:31338177-3133825680ITAM_HUMAN877-903270--
1.23ENST0000028749723ENSE00001191849chr16:31339468-3133955184ITAM_HUMAN903-931290--
1.24ENST0000028749724ENSE00001242085chr16:31340549-3134062476ITAM_HUMAN931-956260--
1.25ENST0000028749725ENSE00001242076chr16:31341119-31341226108ITAM_HUMAN957-992360--
1.26ENST0000028749726ENSE00001191843chr16:31341402-3134148584ITAM_HUMAN993-1020280--
1.27ENST0000028749727ENSE00001191837chr16:31341629-31341742114ITAM_HUMAN1021-1058380--
1.28ENST0000028749728ENSE00001191835chr16:31341825-31341926102ITAM_HUMAN1059-1092340--
1.29ENST0000028749729ENSE00001191829chr16:31342486-31342596111ITAM_HUMAN1093-1129370--
1.30ENST0000028749730ENSE00001330465chr16:31342957-313442131257ITAM_HUMAN1130-1152230--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:195
 aligned with ITAM_HUMAN | P11215 from UniProtKB/Swiss-Prot  Length:1152

    Alignment length:214
                                   155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355    
           ITAM_HUMAN   146 QEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAI 359
               SCOP domains d1na5a_ A: Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit)                                                                                                                                                     SCOP domains
               CATH domains 1na5A00 A:130-324  [code=3.40.50.410, no name defined]                                                                                                                                                                 CATH domains
               Pfam domains ----VWA-1na5A01 A:134-312                                                                                                                                                              ------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.....hhhhhhhhhhhhhhhhhhhh...eeeeeeee...eeeeehhhhhhhh.hhhhhhh.........hhhhhhhhhhhhh.hhhhh.....eeeeeeee.........hhhhhhhhhhhh.eeeeeeee.hhhh....hhhhhhhh..hhhh.eeee.hhhhhhhhhhhhhhhhhh..-------------------.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----VWFA  PDB: A:134-312 UniProt: 150-328                                                                                                                                              ----------FG_GAP  PDB: A:321-32 PROSITE
           Transcript 1 (1) Exon 1.6  PDB: A:130-170 UniProt: 143-186Exon 1.7  PDB: A:171-219 UniProt: 187-235        -----------------------------------------------------------------------------------------------------Exon 1.10 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.8  PDB: A:219-270 UniProt: 235-286           Exon 1.9  PDB: A:271-320 UniProt: 287-337          ---------------------- Transcript 1 (2)
                 1na5 A 130 QEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIG-------------------SPGI 324
                                   139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319|        -         -|   
                                                                                                                                                                                                                        320                 321   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: vWA-like (60)
(-)
Family: VWA (50)

(-) Gene Ontology  (15, 15)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ITAM_HUMAN | P11215)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0010668    ectodermal cell differentiation    The process in which relatively unspecialized cells acquire specialized structural and/or functional features of an ectodermal cell. Differentiation includes the processes involved in commitment of a cell to a specific fate.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0007229    integrin-mediated signaling pathway    A series of molecular signals initiated by the binding of extracellular ligand to an integrin on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0034142    toll-like receptor 4 signaling pathway    Any series of molecular signals generated as a consequence of binding to toll-like receptor 4.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0008305    integrin complex    A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1na5)
 
  Sites
(no "Sites" information available for 1na5)
 
  Cis Peptide Bonds
    Lys A:290 - Pro A:291   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1na5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ITAM_HUMAN | P11215
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ITAM_HUMAN | P11215
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ITAM_HUMAN | P112151a8x 1bho 1bhq 1idn 1ido 1jlm 1m1u 1mf7 1n9z 2lke 2lkj 3q3g 3qa3 4m76 4xw2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1NA5)