Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF YEAST SMF IN SPACEGROUP P43212
 
Authors :  B. M. Collins, L. Cubeddu, N. Naidoo, S. J. Harrop, G. D. Kornfeld, I. W. D P. M. G. Curmi, B. C. Mabbutt
Date :  26 Nov 02  (Deposition) - 13 Dec 02  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.50
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N
Biol. Unit 1:  A,B,C,D,E,F,G  (1x)
Biol. Unit 2:  H,I,J,K,L,M,N  (1x)
Biol. Unit 3:  A,B,C,D,E,F,G,H,I,J,K,L,M,N  (1x)
Keywords :  Snrnp, Sm Protein, Heptamer, Translation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. M. Collins, L. Cubeddu, N. Naidoo, S. J. Harrop, G. D. Kornfeld, I. W. Dawes, P. M. G. Curmi, B. C. Mabbutt
Homomeric Ring Assemblies Of Eukaryotic Sm Proteins Have Affinity For Both Rna And Dna: Crystal Structure Of An Oligomeric Complex Of Yeast Smf
J. Biol. Chem. V. 278 17291 2003
PubMed-ID: 12618433  |  Reference-DOI: 10.1074/JBC.M211826200

(-) Compounds

Molecule 1 - SMALL NUCLEAR RIBONUCLEOPROTEIN F
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymSMF;
SM-LIKE SNRNP PROTEIN;
SNRNP-F;
SM PROTEIN F;
SM-F

 Structural Features

(-) Chains, Units

  1234567891011121314
Asymmetric Unit ABCDEFGHIJKLMN
Biological Unit 1 (1x)ABCDEFG       
Biological Unit 2 (1x)       HIJKLMN
Biological Unit 3 (1x)ABCDEFGHIJKLMN

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1N9S)

(-) Sites  (0, 0)

(no "Site" information available for 1N9S)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1N9S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1N9S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1N9S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1N9S)

(-) Exons   (1, 14)

Asymmetric Unit (1, 14)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YPR182W1YPR182W.1XVI:900190-900450261RUXF_YEAST1-868614A:19-86
B:19-86
C:13-86
D:16-86
E:19-86
F:17-86
G:17-86
H:16-86
I:17-86
J:15-86
K:18-86
L:13-86
M:17-86
N:18-85
68
68
74
71
68
70
70
71
70
72
69
74
70
68

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:68
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:68
                                    28        38        48        58        68        78        
            RUXF_YEAST   19 LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sa_ A: Small nuclear ribonucleoprotein F, Smf                    SCOP domains
               CATH domains 1n9sA00 A:19-86  [code=2.30.30.100, no name defined]                 CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee....eeeeeeeee......eeeeeeeeee..eeeee..........eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:19-86 UniProt: 1-86 [INCOMPLETE]                    Transcript 1
                  1n9s A 19 LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    28        38        48        58        68        78        

Chain B from PDB  Type:PROTEIN  Length:68
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:68
                                    28        38        48        58        68        78        
            RUXF_YEAST   19 LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sb_ B: Small nuclear ribonucleoprotein F, Smf                    SCOP domains
               CATH domains 1n9sB00 B:19-86  [code=2.30.30.100, no name defined]                 CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..........eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:19-86 UniProt: 1-86 [INCOMPLETE]                    Transcript 1
                  1n9s B 19 LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    28        38        48        58        68        78        

Chain C from PDB  Type:PROTEIN  Length:74
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:74
                                    22        32        42        52        62        72        82    
            RUXF_YEAST   13 VNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sc_ C: Small nuclear ribonucleoprotein F, Smf                          SCOP domains
               CATH domains 1n9sC00 C:13-86  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: C:13-86 UniProt: 1-86 [INCOMPLETE]                          Transcript 1
                  1n9s C 13 VNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    22        32        42        52        62        72        82    

Chain D from PDB  Type:PROTEIN  Length:71
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:71
                                    25        35        45        55        65        75        85 
            RUXF_YEAST   16 KPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sd_ D: Small nuclear ribonucleoprotein F, Smf                       SCOP domains
               CATH domains 1n9sD00 D:16-86  [code=2.30.30.100, no name defined]                    CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: D:16-86 UniProt: 1-86 [INCOMPLETE]                       Transcript 1
                  1n9s D 16 KPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    25        35        45        55        65        75        85 

Chain E from PDB  Type:PROTEIN  Length:68
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:68
                                    28        38        48        58        68        78        
            RUXF_YEAST   19 LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9se_ E: Small nuclear ribonucleoprotein F, Smf                    SCOP domains
               CATH domains 1n9sE00 E:19-86  [code=2.30.30.100, no name defined]                 CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: E:19-86 UniProt: 1-86 [INCOMPLETE]                    Transcript 1
                  1n9s E 19 LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    28        38        48        58        68        78        

Chain F from PDB  Type:PROTEIN  Length:70
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:70
                                    26        36        46        56        66        76        86
            RUXF_YEAST   17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sf_ F: Small nuclear ribonucleoprotein F, Smf                      SCOP domains
               CATH domains 1n9sF00 F:17-86  [code=2.30.30.100, no name defined]                   CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: F:17-86 UniProt: 1-86 [INCOMPLETE]                      Transcript 1
                  1n9s F 17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    26        36        46        56        66        76        86

Chain G from PDB  Type:PROTEIN  Length:70
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:70
                                    26        36        46        56        66        76        86
            RUXF_YEAST   17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sg_ G: Small nuclear ribonucleoprotein F, Smf                      SCOP domains
               CATH domains 1n9sG00 G:17-86  [code=2.30.30.100, no name defined]                   CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..eeeeee....eeeeeeeeeee...eeeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: G:17-86 UniProt: 1-86 [INCOMPLETE]                      Transcript 1
                  1n9s G 17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    26        36        46        56        66        76        86

Chain H from PDB  Type:PROTEIN  Length:71
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:71
                                    25        35        45        55        65        75        85 
            RUXF_YEAST   16 KPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sh_ H: Small nuclear ribonucleoprotein F, Smf                       SCOP domains
               CATH domains 1n9sH00 H:16-86  [code=2.30.30.100, no name defined]                    CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee..........eeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: H:16-86 UniProt: 1-86 [INCOMPLETE]                       Transcript 1
                  1n9s H 16 KPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    25        35        45        55        65        75        85 

Chain I from PDB  Type:PROTEIN  Length:70
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:70
                                    26        36        46        56        66        76        86
            RUXF_YEAST   17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9si_ I: Small nuclear ribonucleoprotein F, Smf                      SCOP domains
               CATH domains 1n9sI00 I:17-86  [code=2.30.30.100, no name defined]                   CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..........eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: I:17-86 UniProt: 1-86 [INCOMPLETE]                      Transcript 1
                  1n9s I 17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    26        36        46        56        66        76        86

Chain J from PDB  Type:PROTEIN  Length:72
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:72
                                    24        34        44        54        64        74        84  
            RUXF_YEAST   15 PKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sj_ J: Small nuclear ribonucleoprotein F, Smf                        SCOP domains
               CATH domains 1n9sJ00 J:15-86  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: J:15-86 UniProt: 1-86 [INCOMPLETE]                        Transcript 1
                  1n9s J 15 PKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    24        34        44        54        64        74        84  

Chain K from PDB  Type:PROTEIN  Length:69
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:69
                                    27        37        47        57        67        77         
            RUXF_YEAST   18 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sk_ K: Small nuclear ribonucleoprotein F, Smf                     SCOP domains
               CATH domains 1n9sK00 K:18-86  [code=2.30.30.100, no name defined]                  CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: K:18-86 UniProt: 1-86 [INCOMPLETE]                     Transcript 1
                  1n9s K 18 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    27        37        47        57        67        77         

Chain L from PDB  Type:PROTEIN  Length:74
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:74
                                    22        32        42        52        62        72        82    
            RUXF_YEAST   13 VNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sl_ L: Small nuclear ribonucleoprotein F, Smf                          SCOP domains
               CATH domains 1n9sL00 L:13-86  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: L:13-86 UniProt: 1-86 [INCOMPLETE]                          Transcript 1
                  1n9s L 13 VNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    22        32        42        52        62        72        82    

Chain M from PDB  Type:PROTEIN  Length:70
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:70
                                    26        36        46        56        66        76        86
            RUXF_YEAST   17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 86
               SCOP domains d1n9sm_ M: Small nuclear ribonucleoprotein F, Smf                      SCOP domains
               CATH domains 1n9sM00 M:17-86  [code=2.30.30.100, no name defined]                   CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..eeeeee....eeeeeeeee......eeeeeeeeee..eeeee...eee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: M:17-86 UniProt: 1-86 [INCOMPLETE]                      Transcript 1
                  1n9s M 17 PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN 86
                                    26        36        46        56        66        76        86

Chain N from PDB  Type:PROTEIN  Length:68
 aligned with RUXF_YEAST | P54999 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:68
                                    27        37        47        57        67        77        
            RUXF_YEAST   18 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELP 85
               SCOP domains d1n9sn_ N: Small nuclear ribonucleoprotein F, Smf                    SCOP domains
               CATH domains 1n9sN00 N:18-85  [code=2.30.30.100, no name defined]                 CATH domains
           Pfam domains (1) LSM-1n9sN01 N:18-83                                               -- Pfam domains (1)
           Pfam domains (2) LSM-1n9sN02 N:18-83                                               -- Pfam domains (2)
           Pfam domains (3) LSM-1n9sN03 N:18-83                                               -- Pfam domains (3)
           Pfam domains (4) LSM-1n9sN04 N:18-83                                               -- Pfam domains (4)
           Pfam domains (5) LSM-1n9sN05 N:18-83                                               -- Pfam domains (5)
           Pfam domains (6) LSM-1n9sN06 N:18-83                                               -- Pfam domains (6)
           Pfam domains (7) LSM-1n9sN07 N:18-83                                               -- Pfam domains (7)
           Pfam domains (8) LSM-1n9sN08 N:18-83                                               -- Pfam domains (8)
           Pfam domains (9) LSM-1n9sN09 N:18-83                                               -- Pfam domains (9)
          Pfam domains (10) LSM-1n9sN10 N:18-83                                               -- Pfam domains (10)
          Pfam domains (11) LSM-1n9sN11 N:18-83                                               -- Pfam domains (11)
          Pfam domains (12) LSM-1n9sN12 N:18-83                                               -- Pfam domains (12)
          Pfam domains (13) LSM-1n9sN13 N:18-83                                               -- Pfam domains (13)
          Pfam domains (14) LSM-1n9sN14 N:18-83                                               -- Pfam domains (14)
         Sec.struct. author ........eeeeee....eeeeeeeeeee...eeeeeeeeeee..eeeee...eee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: N:18-85 UniProt: 1-86 [INCOMPLETE]                    Transcript 1
                  1n9s N 18 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELP 85
                                    27        37        47        57        67        77        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 14)

Asymmetric Unit

(-) CATH Domains  (1, 14)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
1a1n9sK00K:18-86
1b1n9sE00E:19-86
1c1n9sN00N:18-85
1d1n9sF00F:17-86
1e1n9sG00G:17-86
1f1n9sI00I:17-86
1g1n9sM00M:17-86
1h1n9sD00D:16-86
1i1n9sH00H:16-86
1j1n9sJ00J:15-86
1k1n9sC00C:13-86
1l1n9sL00L:13-86
1m1n9sA00A:19-86
1n1n9sB00B:19-86

(-) Pfam Domains  (1, 14)

Asymmetric Unit
(-)
Clan: Sm-like (17)
(-)
Family: LSM (13)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L,M,N   (RUXF_YEAST | P54999)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0008380    RNA splicing    The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0000398    mRNA splicing, via spliceosome    The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
cellular component
    GO:0005685    U1 snRNP    A ribonucleoprotein complex that contains small nuclear RNA U1.
    GO:0046540    U4/U6 x U5 tri-snRNP complex    A ribonucleoprotein complex formed by the association of the U4/U6 and U5 small nuclear ribonucleoproteins.
    GO:0005682    U5 snRNP    A ribonucleoprotein complex that contains small nuclear RNA U5.
    GO:0071013    catalytic step 2 spliceosome    A spliceosomal complex that contains three snRNPs, including U5, bound to a splicing intermediate in which the first catalytic cleavage of the 5' splice site has occurred. The precise subunit composition differs significantly from that of the catalytic step 1, or activated, spliceosome, and includes many proteins in addition to those found in the associated snRNPs.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005732    small nucleolar ribonucleoprotein complex    A ribonucleoprotein complex that contains an RNA molecule of the small nucleolar RNA (snoRNA) family and associated proteins. Most are involved in a step of processing of rRNA: cleavage, 2'-O-methylation, or pseudouridylation. The majority, though not all, fall into one of two classes, box C/D type or box H/ACA type.
    GO:0005681    spliceosomal complex    Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1n9s)
 
  Sites
(no "Sites" information available for 1n9s)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1n9s)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1n9s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RUXF_YEAST | P54999
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RUXF_YEAST | P54999
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RUXF_YEAST | P549991n9r 3jcm 5gam 5gan 5gao 5gm6 5gmk 5lj3 5lj5 5lqw 5mps 5mq0 5wsg

(-) Related Entries Specified in the PDB File

1i4k 1i5l 1i81 1i8f 1jr1 1n9r