Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF THE FD BACTERIOPHAGE PVIII COAT PROTEIN IN LIPID BILAYER MEMBRANES
 
Authors :  F. M. Marassi, S. J. Opella
Date :  09 Oct 02  (Deposition) - 27 Nov 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLID-STATE NMR
Resolution :  NOT APPLICABLE
Chains :  Asym. Unit :  A
Keywords :  Fd Coat Protein, Membrane-Bound, Pviii, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. M. Marassi, S. J. Opella
Simultaneous Assignment And Structure Determination Of A Membrane Protein From Nmr Orientational Restraints
Protein Sci. V. 12 403 2003
PubMed-ID: 12592011  |  Reference-DOI: 10.1110/PS.0211503
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MAJOR COAT PROTEIN PVIII
    ChainsA
    Organism ScientificENTEROBACTERIA PHAGE FD
    Organism Taxid10864
    SynonymFILAMENTOUS PHAGE CLONING VECTOR FD-TET

 Structural Features

(-) Chains, Units

  
Asymmetric Unit 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MZT)

(-) Sites  (0, 0)

(no "Site" information available for 1MZT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MZT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MZT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MZT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1MZT)

(-) Exons   (0, 0)

(no "Exon" information available for 1MZT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:39
 aligned with CAPSD_BPFD | P69539 from UniProtKB/Swiss-Prot  Length:73

    Alignment length:39
                                    39        49        59         
            CAPSD_BPFD   30 AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKF 68
               SCOP domains d1mzta_ A:                              SCOP domains
               CATH domains 1mztA00 A:7-45                          CATH domains
               Pfam domains Phage_Coat_Gp8-1mztA01 A:7-45           Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------- PROSITE
                 Transcript --------------------------------------- Transcript
                  1mzt A  7 AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKF 45
                                    16        26        36         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A   (CAPSD_BPFD | P69539)
cellular component
    GO:0019029    helical viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles; the subunits are arranged to form a protein helix with the genetic material contained within. Tobacco mosaic virus has such a capsid structure.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mzt)
 
  Sites
(no "Sites" information available for 1mzt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1mzt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mzt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAPSD_BPFD | P69539
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CAPSD_BPFD | P69539
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAPSD_BPFD | P695391fdm 1ifd 1ifi 1ifj 2c0w 2c0x 2hi5

(-) Related Entries Specified in the PDB File

1fdm FD MAJOR COAT PROTEIN IN SDS MICELLES, NMR, 20 STRUCTURES