Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A SMAD4-SKI COMPLEX
 
Authors :  J. -W. Wu, A. R. Krawitz, J. Chai, W. Li, F. Zhang, K. Luo, Y. Shi
Date :  17 Sep 02  (Deposition) - 21 Jan 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.85
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,C  (1x)
Keywords :  Smad, Ski, Cancer, Tgf-B Signaling, Protein Interaction, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. -W. Wu, A. R. Krawitz, J. Chai, W. Li, F. Zhang, K. Luo, Y. Shi
Structural Mechanism Of Smad4 Recognition By The Nuclear Oncoprotein Ski: Insights On Ski-Mediated Repression Of Tgf-Beta Signaling
Cell(Cambridge, Mass. ) V. 111 357 2002
PubMed-ID: 12419246  |  Reference-DOI: 10.1016/S0092-8674(02)01006-1
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MOTHERS AGAINST DECAPENTAPLEGIC HOMOLOG 4
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentMH2 DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSMAD4, MOTHERS AGAINST DPP HOMOLOG 4, DELETION TARGET IN PANCREATIC CARCINOMA 4, HSMAD4
 
Molecule 2 - SKI ONCOGENE
    ChainsC, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentSMAD4-BINDING DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSKI, C-SKI

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A  D
Biological Unit 2 (1x) BC 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1ZN2Ligand/IonZINC ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1ZN-1Ligand/IonZINC ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1ZN-1Ligand/IonZINC ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS C:247 , CYS C:250 , HIS C:262 , HIS C:264BINDING SITE FOR RESIDUE ZN C 601
2AC2SOFTWARECYS D:247 , CYS D:250 , HIS D:262 , HIS D:264BINDING SITE FOR RESIDUE ZN D 602

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MR1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MR1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (12, 24)

Asymmetric Unit (12, 24)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_022833E330GSMAD4_HUMANDisease (JPS)281875324A/BE330G
02UniProtVAR_036476D351NSMAD4_HUMANUnclassified  ---A/BD351N
03CancerSNPVAR_SMAD4_HUMAN_CCDS11950_1_02 *D351NSMAD4_HUMANDisease (Colorectal cancer)  ---A/BD351N
04UniProtVAR_019571G352RSMAD4_HUMANDisease (JPS)121912581A/BG352R
05UniProtVAR_019572R361CSMAD4_HUMANDisease (JPS)80338963A/BR361C
06UniProtVAR_036477R361HSMAD4_HUMANUnclassified377767347A/BR361H
07CancerSNPVAR_SMAD4_HUMAN_CCDS11950_1_03 *R361HSMAD4_HUMANDisease (Colorectal cancer)  ---A/BR361H
08UniProtVAR_019573G386DSMAD4_HUMANDisease (JP/HHT)28936393A/BG386D
09UniProtVAR_011380D493HSMAD4_HUMANUnclassified28936392A/BD493H
10UniProtVAR_067602I500MSMAD4_HUMANDisease (MYHRS)281875320A/BI500M
11UniProtVAR_067603I500TSMAD4_HUMANDisease (MYHRS)281875321A/BI500T
12UniProtVAR_067604I500VSMAD4_HUMANDisease (MYHRS)281875322A/BI500V
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (12, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_022833E330GSMAD4_HUMANDisease (JPS)281875324AE330G
02UniProtVAR_036476D351NSMAD4_HUMANUnclassified  ---AD351N
03CancerSNPVAR_SMAD4_HUMAN_CCDS11950_1_02 *D351NSMAD4_HUMANDisease (Colorectal cancer)  ---AD351N
04UniProtVAR_019571G352RSMAD4_HUMANDisease (JPS)121912581AG352R
05UniProtVAR_019572R361CSMAD4_HUMANDisease (JPS)80338963AR361C
06UniProtVAR_036477R361HSMAD4_HUMANUnclassified377767347AR361H
07CancerSNPVAR_SMAD4_HUMAN_CCDS11950_1_03 *R361HSMAD4_HUMANDisease (Colorectal cancer)  ---AR361H
08UniProtVAR_019573G386DSMAD4_HUMANDisease (JP/HHT)28936393AG386D
09UniProtVAR_011380D493HSMAD4_HUMANUnclassified28936392AD493H
10UniProtVAR_067602I500MSMAD4_HUMANDisease (MYHRS)281875320AI500M
11UniProtVAR_067603I500TSMAD4_HUMANDisease (MYHRS)281875321AI500T
12UniProtVAR_067604I500VSMAD4_HUMANDisease (MYHRS)281875322AI500V
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (12, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_022833E330GSMAD4_HUMANDisease (JPS)281875324BE330G
02UniProtVAR_036476D351NSMAD4_HUMANUnclassified  ---BD351N
03CancerSNPVAR_SMAD4_HUMAN_CCDS11950_1_02 *D351NSMAD4_HUMANDisease (Colorectal cancer)  ---BD351N
04UniProtVAR_019571G352RSMAD4_HUMANDisease (JPS)121912581BG352R
05UniProtVAR_019572R361CSMAD4_HUMANDisease (JPS)80338963BR361C
06UniProtVAR_036477R361HSMAD4_HUMANUnclassified377767347BR361H
07CancerSNPVAR_SMAD4_HUMAN_CCDS11950_1_03 *R361HSMAD4_HUMANDisease (Colorectal cancer)  ---BR361H
08UniProtVAR_019573G386DSMAD4_HUMANDisease (JP/HHT)28936393BG386D
09UniProtVAR_011380D493HSMAD4_HUMANUnclassified28936392BD493H
10UniProtVAR_067602I500MSMAD4_HUMANDisease (MYHRS)281875320BI500M
11UniProtVAR_067603I500TSMAD4_HUMANDisease (MYHRS)281875321BI500T
12UniProtVAR_067604I500VSMAD4_HUMANDisease (MYHRS)281875322BI500V
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MH2PS51076 MAD homology domain 2 (MH2) profile.SMAD4_HUMAN323-552
 
  2A:323-543
B:323-550
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MH2PS51076 MAD homology domain 2 (MH2) profile.SMAD4_HUMAN323-552
 
  1A:323-543
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MH2PS51076 MAD homology domain 2 (MH2) profile.SMAD4_HUMAN323-552
 
  1-
B:323-550

(-) Exons   (6, 12)

Asymmetric Unit (6, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003785361ENSE00001477855chr1:2160134-21611741041SKI_HUMAN1-3233232C:216-312
D:217-312
97
96
1.4bENST000003785364bENSE00001035938chr1:2234417-2234542126SKI_HUMAN324-365420--
1.5bENST000003785365bENSE00001035943chr1:2234724-2234839116SKI_HUMAN366-404390--
1.6bENST000003785366bENSE00001035948chr1:2235279-2235541263SKI_HUMAN404-492890--
1.7bENST000003785367bENSE00001035949chr1:2235732-2236024293SKI_HUMAN492-589980--
1.8ENST000003785368ENSE00001035950chr1:2237459-2237689231SKI_HUMAN590-666770--
1.9ENST000003785369ENSE00001477851chr1:2238016-22415583543SKI_HUMAN667-728620--

2.2aENST000003984172aENSE00001533125chr18:48573289-48573665377SMAD4_HUMAN1-83830--
2.3ENST000003984173ENSE00000950229chr18:48575056-48575230175SMAD4_HUMAN84-142590--
2.4ENST000003984174ENSE00000996859chr18:48575665-4857569430SMAD4_HUMAN142-152110--
2.7ENST000003984177ENSE00000950230chr18:48581151-48581363213SMAD4_HUMAN152-223720--
2.8ENST000003984178ENSE00000950231chr18:48584495-48584614120SMAD4_HUMAN223-263410--
2.9ENST000003984179ENSE00000950232chr18:48584710-48584826117SMAD4_HUMAN263-302400--
2.10ENST0000039841710ENSE00000950233chr18:48586236-4858628651SMAD4_HUMAN302-319182A:319-319
B:319-319
1
1
2.11ENST0000039841711ENSE00000950234chr18:48591793-48591976184SMAD4_HUMAN319-380622A:319-380
B:319-380
62
62
2.12ENST0000039841712ENSE00000950235chr18:48593389-48593557169SMAD4_HUMAN380-436572A:380-436
B:380-436
57
57
2.13ENST0000039841713ENSE00000950236chr18:48603008-48603146139SMAD4_HUMAN437-483472A:437-461
B:437-452
25
16
2.14bENST0000039841714bENSE00001533123chr18:48604626-486114156790SMAD4_HUMAN483-552702A:492-543
B:492-550
52
59

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:195
 aligned with SMAD4_HUMAN | Q13485 from UniProtKB/Swiss-Prot  Length:552

    Alignment length:225
                                   328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538     
          SMAD4_HUMAN   319 APEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTM 543
               SCOP domains d1mr1a_ A: Smad4 tumor suppressor C-terminal domain                                                                                                                                                                               SCOP domains
               CATH domains 1mr1A00 A:319-543  [code=2.60.200.10, no name defined]                                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeee..ee....eeee....eeeee.........eee.........hhhhhhhhh.....eeeeee...eeeeee.....eeeehhhhhhhhh......eeee....eeeeehhhhhhhhhhhhhhhhhh.....------------------------------........eeeee............hhhhh..eeeeeehhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) -----------G--------------------NR--------C------------------------D----------------------------------------------------------------------------------------------------------H------M------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------N---------H------------------------------------------------------------------------------------------------------------------------------------------T------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------------V------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ----MH2  PDB: A:323-543 UniProt: 323-552                                                                                                                                                                                          PROSITE
           Transcript 2 (1) 2------------------------------------------------------------Exon 2.12  PDB: A:380-436 UniProt: 380-436               Exon 2.13  PDB: A:437-461 UniProt: 437-483     ------------------------------------------------------------ Transcript 2 (1)
           Transcript 2 (2) Exon 2.11  PDB: A:319-380 UniProt: 319-380                    ------------------------------------------------------------------------------------------------------Exon 2.14b  PDB: A:492-543 UniProt: 483-552 [INCOMPLETE]      Transcript 2 (2)
                 1mr1 A 319 APEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQ------------------------------VDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTM 543
                                   328       338       348       358       368       378       388       398       408       418       428       438       448       458  |      -         -         -   |   498       508       518       528       538     
                                                                                                                                                                        461                            492                                                   

Chain B from PDB  Type:PROTEIN  Length:193
 aligned with SMAD4_HUMAN | Q13485 from UniProtKB/Swiss-Prot  Length:552

    Alignment length:232
                                   328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548  
          SMAD4_HUMAN   319 APEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQP 550
               SCOP domains d1mr1b_ B: Smad4 tumor suppressor C-terminal domain                                                                                                                                                                                      SCOP domains
               CATH domains 1mr1B00 B:319-550  [code=2.60.200.10, no name defined]                                                                                                                                                                                   CATH domains
           Pfam domains (1) MH2-1mr1B01 B:319-532                                                                                                                                                                                                 ------------------ Pfam domains (1)
           Pfam domains (2) MH2-1mr1B02 B:319-532                                                                                                                                                                                                 ------------------ Pfam domains (2)
         Sec.struct. author ...eeeeeeeee..ee....eeee....eeeee.........eee.hhh.....hhhhhhhhhh....eeeeee...eeeeee.....eeeehhhhhhhhh......eeee....eeeeehhhhhhhhhhh...---------------------------------------hhhhhh..eeeee............hhhhh..eeeeeehhhhhhhhhhhh......... Sec.struct. author
             SAPs(SNPs) (1) -----------G--------------------NR--------C------------------------D----------------------------------------------------------------------------------------------------------H------M-------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------N---------H------------------------------------------------------------------------------------------------------------------------------------------T-------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------------V-------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ----MH2  PDB: B:323-550 UniProt: 323-552                                                                                                                                                                                                 PROSITE
           Transcript 2 (1) 2------------------------------------------------------------Exon 2.12  PDB: B:380-436 UniProt: 380-436               Exon 2.13  PDB: B:437-452 UniProt: 437-483     ------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) Exon 2.11  PDB: B:319-380 UniProt: 319-380                    ------------------------------------------------------------------------------------------------------Exon 2.14b  PDB: B:492-550 UniProt: 483-552 [INCOMPLETE]             Transcript 2 (2)
                 1mr1 B 319 APEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAA---------------------------------------VDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQP 550
                                   328       338       348       358       368       378       388       398       408       418       428       438       448   |     -         -         -         -   |   498       508       518       528       538       548  
                                                                                                                                                               452                                     492                                                          

Chain C from PDB  Type:PROTEIN  Length:97
 aligned with SKI_HUMAN | P12755 from UniProtKB/Swiss-Prot  Length:728

    Alignment length:97
                                   225       235       245       255       265       275       285       295       305       
            SKI_HUMAN   216 RSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFD 312
               SCOP domains d1mr1c_ C: SMAD4-binding domain of oncoprotein Ski                                                SCOP domains
               CATH domains 1mr1C00 C:216-312 SAND domain                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeeee.hhhh.......eee.....eehhhhhh..........eeee..hhhhhhhhhee.......hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: C:216-312 UniProt: 1-323 [INCOMPLETE]                                              Transcript 1
                 1mr1 C 216 SHMRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFD 312
                                   225       235       245       255       265       275       285       295       305       

Chain D from PDB  Type:PROTEIN  Length:96
 aligned with SKI_HUMAN | P12755 from UniProtKB/Swiss-Prot  Length:728

    Alignment length:96
                                   226       236       246       256       266       276       286       296       306      
            SKI_HUMAN   217 SVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFD 312
               SCOP domains d1mr1d_ D: SMAD4-binding domain of oncoprotein Ski                                               SCOP domains
               CATH domains 1mr1D00 D:217-312 SAND domain                                                                    CATH domains
           Pfam domains (1) --c-SKI_SMAD_bind-1mr1D01 D:219-312                                                              Pfam domains (1)
           Pfam domains (2) --c-SKI_SMAD_bind-1mr1D02 D:219-312                                                              Pfam domains (2)
         Sec.struct. author .eeeee.....eeeee.hhhh.......eee.....eehhhhhh..........eeee..hhhhhhhh.ee........hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: D:217-312 UniProt: 1-323 [INCOMPLETE]                                             Transcript 1
                 1mr1 D 217 HMRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFD 312
                                   226       236       246       256       266       276       286       296       306      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 4)

Asymmetric Unit
(-)
Clan: SMAD-FHA (27)
(-)
Family: MH2 (8)
1aMH2-1mr1B01B:319-532
1bMH2-1mr1B02B:319-532

(-) Gene Ontology  (145, 160)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (SMAD4_HUMAN | Q13485)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0070411    I-SMAD binding    Interacting selectively and non-covalently with an inhibitory SMAD signaling protein.
    GO:0070412    R-SMAD binding    Interacting selectively and non-covalently with a receptor-regulated SMAD signaling protein.
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0000977    RNA polymerase II regulatory region sequence-specific DNA binding    Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
    GO:0001085    RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0005518    collagen binding    Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0000987    core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to the core promoter. The transcribed region might be described as a gene, cistron, or operon.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0001076    transcription factor activity, RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to modulate transcription. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
    GO:0000988    transcription factor activity, protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in order to modulate transcription. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0001077    transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
    GO:0001228    transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in the transcription regulatory region for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
    GO:0030616    transforming growth factor beta receptor, common-partner cytoplasmic mediator activity    A TGF-beta cytoplasmic mediator that forms a complex with a phosphorylated pathway-specific mediator. The heterocomplex translocates to the nucleus to regulate transcription.
biological process
    GO:0030509    BMP signaling pathway    A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007183    SMAD protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex that contains SMAD proteins.
    GO:0060395    SMAD protein signal transduction    The cascade of processes by which a signal interacts with a receptor, causing a change in the activity of a SMAD protein, and ultimately effecting a change in the functioning of the cell.
    GO:0009952    anterior/posterior pattern specification    The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
    GO:0036302    atrioventricular canal development    The progression of the atrioventricular canal over time, from its formation to the mature structure. The atrioventricular canal is the part of the heart connecting the atrium to the cardiac ventricle.
    GO:0003190    atrioventricular valve formation    The developmental process pertaining to the initial formation of the atrioventricular valve from unspecified parts. This process begins with the specific processes that contribute to the appearance of the discrete structure and ends when the structural rudiment is recognizable.
    GO:0007411    axon guidance    The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
    GO:0003360    brainstem development    The progression of the brainstem from its formation to the mature structure. The brainstem is the part of the brain that connects the brain with the spinal cord.
    GO:0001658    branching involved in ureteric bud morphogenesis    The process in which the branching structure of the ureteric bud is generated and organized. The ureteric bud is an epithelial tube that grows out from the metanephric duct. The bud elongates and branches to give rise to the ureter and kidney collecting tubules.
    GO:0003279    cardiac septum development    The progression of a cardiac septum over time, from its initial formation to the mature structure.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0006879    cellular iron ion homeostasis    Any process involved in the maintenance of an internal steady state of iron ions at the level of a cell.
    GO:0071773    cellular response to BMP stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
    GO:0048589    developmental growth    The increase in size or mass of an entire organism, a part of an organism or a cell, where the increase in size or mass has the specific outcome of the progression of the organism over time from one condition to another.
    GO:0042733    embryonic digit morphogenesis    The process, occurring in the embryo, by which the anatomical structures of the digit are generated and organized. A digit is one of the terminal divisions of an appendage, such as a finger or toe.
    GO:0060956    endocardial cell differentiation    The process in which a relatively unspecialized cell acquires the specialized structural and/or functional features of an endocardial cell. An endocardial cell is a specialized endothelial cell that makes up the endocardium portion of the heart. The endocardium is the innermost layer of tissue of the heart, and lines the heart chambers.
    GO:0007492    endoderm development    The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
    GO:0042118    endothelial cell activation    The change in morphology and behavior of an endothelial cell resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
    GO:0003198    epithelial to mesenchymal transition involved in endocardial cushion formation    A transition where a cardiac epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell that will contribute to the formation of the endocardial cushion.
    GO:0008585    female gonad development    The process whose specific outcome is the progression of the female gonad over time, from its formation to the mature structure.
    GO:0061040    female gonad morphogenesis    The process in which a female gonad is generated and organized.
    GO:0048859    formation of anatomical boundary    The process in which the limits of an anatomical structure are generated. An anatomical structure is any biological entity that occupies space and is distinguished from its surroundings. Anatomical structures can be macroscopic such as a carpel, or microscopic such as an acrosome.
    GO:0007369    gastrulation    A complex and coordinated series of cellular movements that occurs at the end of cleavage during embryonic development of most animals. The details of gastrulation vary from species to species, but usually result in the formation of the three primary germ layers, ectoderm, mesoderm and endoderm.
    GO:0001702    gastrulation with mouth forming second    A gastrulation process in which the initial invagination becomes the anus and the mouth forms second.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0070102    interleukin-6-mediated signaling pathway    A series of molecular signals initiated by the binding of interleukin-6 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0001822    kidney development    The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0007498    mesoderm development    The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
    GO:0072133    metanephric mesenchyme morphogenesis    The process in which the anatomical structures of a metanephric mesenchymal tissue are generated and organized. Metanephric mesenchyme is the tissue made up of loosely connected mesenchymal cells in the metanephros.
    GO:0060548    negative regulation of cell death    Any process that decreases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0072134    nephrogenic mesenchyme morphogenesis    The process in which the anatomical structures of a nephrogenic mesenchymal tissue are generated and organized. Nephrogenic mesenchyme is the tissue made up of loosely connected mesenchymal cells in the nephron.
    GO:0014033    neural crest cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a neural crest cell.
    GO:0048663    neuron fate commitment    The process in which the developmental fate of a cell becomes restricted such that it will develop into a neuron.
    GO:0001541    ovarian follicle development    The process whose specific outcome is the progression of the ovarian follicle over time, from its formation to the mature structure.
    GO:0060021    palate development    The biological process whose specific outcome is the progression of the palate from an initial condition to its mature state. This process begins with the formation of the structure and ends with the mature structure. The palate is the partition that separates the nasal and oral cavities.
    GO:0030513    positive regulation of BMP signaling pathway    Any process that activates or increases the frequency, rate or extent of BMP signaling pathway activity.
    GO:0060391    positive regulation of SMAD protein import into nucleus    Any process that increases the rate, frequency or extent of SMAD protein import into the nucleus, i.e. the directed movement of a SMAD proteins from the cytoplasm into the nucleus. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0003251    positive regulation of cell proliferation involved in heart valve morphogenesis    Any process that increases the rate, frequency or extent of cell proliferation that contributes to the shaping of a heart valve.
    GO:0010718    positive regulation of epithelial to mesenchymal transition    Any process that increases the rate, frequency, or extent of epithelial to mesenchymal transition. Epithelial to mesenchymal transition is where an epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
    GO:0046881    positive regulation of follicle-stimulating hormone secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of follicle-stimulating hormone.
    GO:0051571    positive regulation of histone H3-K4 methylation    Any process that activates or increases the frequency, rate or extent of the covalent addition of a methyl group to the lysine at position 4 of histone H3.
    GO:2000617    positive regulation of histone H3-K9 acetylation    Any process that activates or increases the frequency, rate or extent of histone H3-K9 acetylation.
    GO:0033686    positive regulation of luteinizing hormone secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of luteinizing hormone.
    GO:0010862    positive regulation of pathway-restricted SMAD protein phosphorylation    Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:1901522    positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus    Any positive regulation of transcription from RNA polymerase II promoter that is involved in cellular response to chemical stimulus.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0030511    positive regulation of transforming growth factor beta receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of TGF-beta receptor signaling pathway activity.
    GO:0051098    regulation of binding    Any process that modulates the frequency, rate or extent of binding, the selective interaction of a molecule with one or more specific sites on another molecule.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0051797    regulation of hair follicle development    Any process that modulates the frequency, rate or extent of hair follicle development.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0017015    regulation of transforming growth factor beta receptor signaling pathway    Any process that modulates the frequency, rate or extent of activity of any TGF-beta receptor signaling pathway.
    GO:0032909    regulation of transforming growth factor beta2 production    Any process that modulates the frequency, rate, or extent of production of transforming growth factor-beta2.
    GO:0001666    response to hypoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0071559    response to transforming growth factor beta    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
    GO:0048733    sebaceous gland development    The process whose specific outcome is the progression of the sebaceous gland over time, from its formation to the mature structure.
    GO:0072520    seminiferous tubule development    The reproductive developmental process whose specific outcome is the progression of the seminiferous tubule over time, from its formation to the mature structure. Seminiferous tubules are ducts located in the testicles, and are the specific location of meiosis, and the subsequent creation of gametes, namely spermatozoa.
    GO:0007338    single fertilization    The union of male and female gametes to form a zygote.
    GO:0035019    somatic stem cell population maintenance    Any process by which an organism retains a population of somatic stem cells, undifferentiated cells in the embryo or adult which can undergo unlimited division and give rise to cell types of the body other than those of the germ-line.
    GO:0032525    somite rostral/caudal axis specification    The establishment, maintenance and elaboration of the rostro-caudal axis of a somite, prior to the morphological formation of a somite boundary.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
    GO:0048729    tissue morphogenesis    The process in which the anatomical structures of a tissue are generated and organized.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0060065    uterus development    The reproductive developmental process whose specific outcome is the progression of the uterus over time, from its formation to the mature structure.
cellular component
    GO:0090575    RNA polymerase II transcription factor complex    A transcription factor complex that acts at promoters of genes transcribed by RNA polymerase II.
    GO:0071141    SMAD protein complex    A protein complex that consists of only SMAD proteins; may be homomeric or heteromeric.
    GO:0032444    activin responsive factor complex    A transcriptionally active complex that binds to an activin response element (ARE) in the promoter of target genes, and is composed of two SMAD2 proteins, one SMAD4 protein and a Forkhead activin signal transducer (FAST) transcription factor.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0000790    nuclear chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005667    transcription factor complex    A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Chain C,D   (SKI_HUMAN | P12755)
molecular function
    GO:0046332    SMAD binding    Interacting selectively and non-covalently with a SMAD signaling protein.
    GO:0046811    histone deacetylase inhibitor activity    Stops, prevents or reduces the activity of histone deacetylase, which catalyzes of the removal of acetyl groups from histones, proteins complexed to DNA in chromatin and chromosomes.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0070491    repressing transcription factor binding    Interacting selectively and non-covalently with a transcription repressor, any protein whose activity is required to prevent or downregulate transcription.
    GO:0003714    transcription corepressor activity    Interacting selectively and non-covalently with a repressing transcription factor and also with the basal transcription machinery in order to stop, prevent, or reduce the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between repressive transcription factors and the basal transcription machinery.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0030509    BMP signaling pathway    A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0060395    SMAD protein signal transduction    The cascade of processes by which a signal interacts with a receptor, causing a change in the activity of a SMAD protein, and ultimately effecting a change in the functioning of the cell.
    GO:0009948    anterior/posterior axis specification    The establishment, maintenance and elaboration of the anterior/posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
    GO:0060349    bone morphogenesis    The process in which bones are generated and organized.
    GO:0043010    camera-type eye development    The process whose specific outcome is the progression of the camera-type eye over time, from its formation to the mature structure. The camera-type eye is an organ of sight that receives light through an aperture and focuses it through a lens, projecting it on a photoreceptor field.
    GO:0048593    camera-type eye morphogenesis    The process in which the anatomical structures of the eye are generated and organized. The camera-type eye is an organ of sight that receives light through an aperture and focuses it through a lens, projecting it on a photoreceptor field.
    GO:0048870    cell motility    Any process involved in the controlled self-propelled movement of a cell that results in translocation of the cell from one place to another.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0030326    embryonic limb morphogenesis    The process, occurring in the embryo, by which the anatomical structures of the limb are generated and organized. A limb is an appendage of an animal used for locomotion or grasping.
    GO:0060325    face morphogenesis    The process in which the anatomical structures of the face are generated and organized. The face is the ventral division of the head.
    GO:0002089    lens morphogenesis in camera-type eye    The process in which the anatomical structures of the lens are generated and organized. The lens is a transparent structure in the eye through which light is focused onto the retina. An example of this process is found in Mus musculus.
    GO:0022011    myelination in peripheral nervous system    The process in which neuronal axons and dendrites become coated with a segmented lipid-rich sheath (myelin) to enable faster and more energetically efficient conduction of electrical impulses. The sheath is formed by the cell membranes of Schwann cells in the peripheral nervous system. Adjacent myelin segments are separated by a non-myelinated stretch of axon called a node of Ranvier.
    GO:0014902    myotube differentiation    The process in which a relatively unspecialized cell acquires specialized features of a myotube cell. Myotube differentiation starts with myoblast fusion and the appearance of specific cell markers (this is the cell development step). Then individual myotubes can fuse to form bigger myotubes and start to contract. Myotubes are multinucleated cells that are formed when proliferating myoblasts exit the cell cycle, differentiate and fuse.
    GO:0030514    negative regulation of BMP signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
    GO:0010626    negative regulation of Schwann cell proliferation    Any process that decreases the frequency or extent of the multiplication or reproduction of Schwann cells, resulting in the expansion of their population. Schwann cells are a type of glial cell in the peripheral nervous system.
    GO:0032926    negative regulation of activin receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of any activin receptor signaling pathway.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0048147    negative regulation of fibroblast proliferation    Any process that stops, prevents, or reduces the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
    GO:0031064    negative regulation of histone deacetylation    Any process that stops, prevents, or reduces the frequency, rate or extent of the removal of acetyl groups from histones.
    GO:0045668    negative regulation of osteoblast differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of osteoblast differentiation.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
    GO:0001843    neural tube closure    The last step in the formation of the neural tube, where the paired neural folds are brought together and fuse at the dorsal midline.
    GO:0043585    nose morphogenesis    The process in which the anatomical structures of the nose are generated and organized. The nose is the specialized structure of the face that serves as the organ of the sense of smell and as part of the respiratory system. Includes the nasi externus (external nose) and cavitas nasi (nasal cavity).
    GO:0021772    olfactory bulb development    The progression of the olfactory bulb over time from its initial formation until its mature state. The olfactory bulb coordinates neuronal signaling involved in the perception of smell. It receives input from the sensory neurons and outputs to the olfactory cortex.
    GO:0060021    palate development    The biological process whose specific outcome is the progression of the palate from an initial condition to its mature state. This process begins with the formation of the structure and ends with the mature structure. The palate is the partition that separates the nasal and oral cavities.
    GO:0043388    positive regulation of DNA binding    Any process that increases the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:0030177    positive regulation of Wnt signaling pathway    Any process that activates or increases the frequency, rate or extent of Wnt signal transduction.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0070207    protein homotrimerization    The formation of a protein homotrimer, a macromolecular structure consisting of three noncovalently associated identical subunits.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:0060041    retina development in camera-type eye    The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
    GO:0048741    skeletal muscle fiber development    The process whose specific outcome is the progression of the skeletal muscle fiber over time, from its formation to the mature structure. Muscle fibers are formed by the maturation of myotubes. They can be classed as slow, intermediate/fast or fast.
    GO:0035019    somatic stem cell population maintenance    Any process by which an organism retains a population of somatic stem cells, undifferentiated cells in the embryo or adult which can undergo unlimited division and give rise to cell types of the body other than those of the germ-line.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0016605    PML body    A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0016604    nuclear body    Extra-nucleolar nuclear domains usually visualized by confocal microscopy and fluorescent antibodies to specific proteins.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0005667    transcription factor complex    A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.
    GO:0017053    transcriptional repressor complex    A protein complex that possesses activity that prevents or downregulates transcription.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1mr1)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mr1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SKI_HUMAN | P12755
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SMAD4_HUMAN | Q13485
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  139210
    Disease InformationOMIM
  174900
    Disease InformationOMIM
  175050
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SKI_HUMAN | P12755
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SMAD4_HUMAN | Q13485
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SKI_HUMAN | P127551sbx
        SMAD4_HUMAN | Q134851dd1 1g88 1u7f 1u7v 1ygs 5c4v 5uwu

(-) Related Entries Specified in the PDB File

1ygs 1YGS IS THE CRYSTAL STRUCTURE OF THE SMAD4 TUMOR SUPPRESSOR C-TERMINAL DOMAIN