Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AQUIFEX AEOLICUS N-UTILIZATION SUBSTANCE G (NUSG), SPACE GROUP P2(1)
 
Authors :  T. Steiner, J. T. Kaiser, S. Marinkovic, R. Huber, M. C. Wahl
Date :  19 Jun 02  (Deposition) - 04 Feb 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  C (1x),D (1x)
Biol. Unit 6:  A (1x),B (1x)
Keywords :  Transcription Termination, Antitermination, Kow Domain, Rnp Motif, Immunoglobulin Fold, Nucleic Acid Interaction, Protein-Protein Interaction (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Steiner, J. T. Kaiser, S. Marinkovic, R. Huber, M. C. Wahl
Crystal Structures Of Transcription Factor Nusg In Light Of Its Nucleic Acid- And Protein-Binding Activities
Embo J. V. 21 4641 2002
PubMed-ID: 12198166  |  Reference-DOI: 10.1093/EMBOJ/CDF455
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRANSCRIPTION ANTITERMINATION PROTEIN NUSG
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPET22B(+)
    Expression System Vector TypePLASMID
    Organism ScientificAQUIFEX AEOLICUS
    Organism Taxid63363

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D
Biological Unit 5 (1x)  C (1x)D (1x)
Biological Unit 6 (1x)A (1x)B (1x)  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1M1G)

(-) Sites  (0, 0)

(no "Site" information available for 1M1G)

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:104 -A:119
2B:104 -B:119
3C:104 -C:119
4D:104 -D:119

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Lys A:189 -Pro A:190
2Lys D:189 -Pro D:190

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1M1G)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUSGPS01014 Transcription termination factor nusG signature.NUSG_AQUAE231-240
 
 
 
  4A:231-240
B:231-240
C:231-240
D:231-240
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUSGPS01014 Transcription termination factor nusG signature.NUSG_AQUAE231-240
 
 
 
  1A:231-240
-
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUSGPS01014 Transcription termination factor nusG signature.NUSG_AQUAE231-240
 
 
 
  1-
B:231-240
-
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUSGPS01014 Transcription termination factor nusG signature.NUSG_AQUAE231-240
 
 
 
  1-
-
C:231-240
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUSGPS01014 Transcription termination factor nusG signature.NUSG_AQUAE231-240
 
 
 
  1-
-
-
D:231-240
Biological Unit 5 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUSGPS01014 Transcription termination factor nusG signature.NUSG_AQUAE231-240
 
 
 
  2-
-
C:231-240
D:231-240
Biological Unit 6 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUSGPS01014 Transcription termination factor nusG signature.NUSG_AQUAE231-240
 
 
 
  2A:231-240
B:231-240
-
-

(-) Exons   (0, 0)

(no "Exon" information available for 1M1G)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:240
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:240
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248
           NUSG_AQUAE     9 LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1ga3 A:9-50,A:132-190                  d1m1ga1 A:51-131 N-utilization substance G protein NusG, insert domain           d1m1ga3 A:9-50,A:132-190                                   d1m1ga2 A:191-248                                          SCOP domains
               CATH domains 1m1gA01 A:9-49,A:132-185                 1m1gA02 A:50-131 NusG, domain 2                                                   1m1gA01 A:9-49,A:132-185                              1m1gA03 A:186-247  [code=2.30.30.30, no name defined]         - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeee...hhhhhhhhhhhhhhhhh....eeeee...eeeeeeee...eeeeee.....eeeeee....eeeeeee..eeeeee....hhhhhh........eeee....eeeeeeee......eeeeee..hhhhhhhhhhh..eeee.ee..ee.eehhhhhhhhhhhhhh.............eeee........eeeeeeee....eeeeeeee..eeeeeeee...eeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1m1g A   9 LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248

Chain B from PDB  Type:PROTEIN  Length:242
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:242
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246  
           NUSG_AQUAE     7 QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1gb3 B:7-50,B:132-190                    d1m1gb1 B:51-131 N-utilization substance G protein NusG, insert domain           d1m1gb3 B:7-50,B:132-190                                   d1m1gb2 B:191-248                                          SCOP domains
               CATH domains --1m1gB01 B:9-49,B:132-185                 1m1gB02 B:50-131 NusG, domain 2                                                   1m1gB01 B:9-49,B:132-185                              1m1gB03 B:186-248  [code=2.30.30.30, no name defined]           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee...hhhhhhhhhhhhhhhhhhhh.eeeee...eeeeeeee...eeeeee.....eeeeee....eeeeee....eeeee....hhhhh.........eeee....eeeeeeee......eeeeee..hhhhhhhhhh...eeee.ee..ee.eehhhhhhhhhh.................eeee........eeee.........eeeeeee..eeeeeeehhh.eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m1g B   7 QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246  

Chain C from PDB  Type:PROTEIN  Length:244
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:244
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244    
           NUSG_AQUAE     5 QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1gc3 C:5-50,C:132-190                      d1m1gc1 C:51-131 N-utilization substance G protein NusG, insert domain           d1m1gc3 C:5-50,C:132-190                                   d1m1gc2 C:191-248                                          SCOP domains
               CATH domains ----1m1gC01 C:9-49,C:132-185                 1m1gC02 C:50-131 NusG, domain 2                                                   1m1gC01 C:9-49,C:132-185                              1m1gC03 C:186-247  [code=2.30.30.30, no name defined]         - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee...hhhhhhhhhhhhhhhhhhhh.eeeee...eeeeeeee...eeeeee.....eeeeee....eeeeee....eeeee.....hhhhh........eeee....eeeeeeee......eeeeee..hhhhhhhhhh...eeee.ee..ee...hhhhhhhhhhhhh..............eeee........eeeeeeee....eeeeeeee..eeeeeeee...eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m1g C   5 QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244    

Chain D from PDB  Type:PROTEIN  Length:239
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:239
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239         
           NUSG_AQUAE    10 EKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1gd3 D:10-50,D:132-190                d1m1gd1 D:51-131 N-utilization substance G protein NusG, insert domain           d1m1gd3 D:10-50,D:132-190                                  d1m1gd2 D:191-248                                          SCOP domains
               CATH domains 1m1gD01 D:10-49,D:132-185               1m1gD02 D:50-131 NusG, domain 2                                                   1m1gD01 D:10-49,D:132-185                             1m1gD03 D:186-248  [code=2.30.30.30, no name defined]           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...hhhhhhhhhhhhhhhh.hhh.eeeee...eeeeeeee...eeeeee......eeeee....eeeeee....eeeee....hhhhh.........eeee....eeeeeeee......eeeeee..hhhhhhhhhhh..eeee.ee..ee...hhhhhhhhhhhhhhh............................................................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m1g D  10 EKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 12)

Asymmetric Unit

(-) CATH Domains  (3, 12)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1M1G)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (NUSG_AQUAE | O67757)
biological process
    GO:0006354    DNA-templated transcription, elongation    The extension of an RNA molecule after transcription initiation and promoter clearance at a DNA-dependent RNA polymerase promoter by the addition of ribonucleotides catalyzed by an RNA polymerase.
    GO:0006353    DNA-templated transcription, termination    The cellular process that completes DNA-templated transcription; the formation of phosphodiester bonds ceases, the RNA-DNA hybrid dissociates, and RNA polymerase releases the DNA.
    GO:0032784    regulation of DNA-templated transcription, elongation    Any process that modulates the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides catalyzed by a DNA-dependent RNA polymerase.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0031564    transcription antitermination    Regulation of transcription by a mechanism that allows RNA polymerase to continue transcription beyond termination site(s).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1m1g)
 
  Sites
(no "Sites" information available for 1m1g)
 
  Cis Peptide Bonds
    Lys A:189 - Pro A:190   [ RasMol ]  
    Lys D:189 - Pro D:190   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1m1g
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NUSG_AQUAE | O67757
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NUSG_AQUAE | O67757
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NUSG_AQUAE | O677571m1h 1npp 1npr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1M1G)