1M1G - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF AQUIFEX AEOLICUS N-UTILIZATION SUBSTANCE G (NUSG), SPACE GROUP P2(1)

Authors :   T. Steiner, J. T. Kaiser, S. Marinkovic, R. Huber, M. C. Wahl

Date :   19 Jun 02 (Deposition) - 04 Feb 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: C (1x),D (1x)
Biol. Unit 6: A (1x),B (1x)

Keywords :   Transcription Termination, Antitermination, Kow Domain, Rnp Motif, Immunoglobulin Fold, Nucleic Acid Interaction, Protein-Protein Interaction (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Steiner, J. T. Kaiser, S. Marinkovic, R. Huber, M. C. Wahl
Crystal Structures Of Transcription Factor Nusg In Light Of Its Nucleic Acid- And Protein-Binding Activities
Embo J. V. 21 4641 2002
PubMed-ID: 12198166 | Reference-DOI: 10.1093/EMBOJ/CDF455
(for further references see the PDB file header)

Molecule 1 - TRANSCRIPTION ANTITERMINATION PROTEIN NUSG
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector	:	PET22B(+)
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	AQUIFEX AEOLICUS
	Organism Taxid	:	63363

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:			C (1x)	D (1x)
Biological Unit 6 (1x)	:	A (1x)	B (1x)

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1M1G)

(no "Site" information available for 1M1G)

Asymmetric Unit

No.	Residues
1	A:104	-	A:119
2	B:104	-	B:119
3	C:104	-	C:119
4	D:104	-	D:119

Asymmetric Unit

No.	Residues
1	Lys A:189	-	Pro A:190
2	Lys D:189	-	Pro D:190

(no "SAP(SNP)/Variant" information available for 1M1G)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NUSG	PS01014	Transcription termination factor nusG signature.	NUSG_AQUAE	231-240	4	A:231-240 B:231-240 C:231-240 D:231-240

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NUSG	PS01014	Transcription termination factor nusG signature.	NUSG_AQUAE	231-240	1	A:231-240 - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NUSG	PS01014	Transcription termination factor nusG signature.	NUSG_AQUAE	231-240	1	- B:231-240 - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NUSG	PS01014	Transcription termination factor nusG signature.	NUSG_AQUAE	231-240	1	- - C:231-240 -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NUSG	PS01014	Transcription termination factor nusG signature.	NUSG_AQUAE	231-240	1	- - - D:231-240

Biological Unit 5 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NUSG	PS01014	Transcription termination factor nusG signature.	NUSG_AQUAE	231-240	2	- - C:231-240 D:231-240

Biological Unit 6 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	NUSG	PS01014	Transcription termination factor nusG signature.	NUSG_AQUAE	231-240	2	A:231-240 B:231-240 - -

(no "Exon" information available for 1M1G)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:240
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:240
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248
           NUSG_AQUAE     9 LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1ga3 A:9-50,A:132-190                  d1m1ga1 A:51-131 N-utilization substance G protein NusG, insert domain           d1m1ga3 A:9-50,A:132-190                                   d1m1ga2 A:191-248                                          SCOP domains
               CATH domains 1m1gA01 A:9-49,A:132-185                 1m1gA02 A:50-131 NusG, domain 2                                                   1m1gA01 A:9-49,A:132-185                              1m1gA03 A:186-247  [code=2.30.30.30, no name defined]         - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeee...hhhhhhhhhhhhhhhhh....eeeee...eeeeeeee...eeeeee.....eeeeee....eeeeeee..eeeeee....hhhhhh........eeee....eeeeeeee......eeeeee..hhhhhhhhhhh..eeee.ee..ee.eehhhhhhhhhhhhhh.............eeee........eeeeeeee....eeeeeeee..eeeeeeee...eeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1m1g A   9 LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248

Chain B from PDB  Type:PROTEIN  Length:242
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:242
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246  
           NUSG_AQUAE     7 QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1gb3 B:7-50,B:132-190                    d1m1gb1 B:51-131 N-utilization substance G protein NusG, insert domain           d1m1gb3 B:7-50,B:132-190                                   d1m1gb2 B:191-248                                          SCOP domains
               CATH domains --1m1gB01 B:9-49,B:132-185                 1m1gB02 B:50-131 NusG, domain 2                                                   1m1gB01 B:9-49,B:132-185                              1m1gB03 B:186-248  [code=2.30.30.30, no name defined]           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee...hhhhhhhhhhhhhhhhhhhh.eeeee...eeeeeeee...eeeeee.....eeeeee....eeeeee....eeeee....hhhhh.........eeee....eeeeeeee......eeeeee..hhhhhhhhhh...eeee.ee..ee.eehhhhhhhhhh.................eeee........eeee.........eeeeeee..eeeeeeehhh.eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m1g B   7 QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246

Chain C from PDB  Type:PROTEIN  Length:244
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:244
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244    
           NUSG_AQUAE     5 QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1gc3 C:5-50,C:132-190                      d1m1gc1 C:51-131 N-utilization substance G protein NusG, insert domain           d1m1gc3 C:5-50,C:132-190                                   d1m1gc2 C:191-248                                          SCOP domains
               CATH domains ----1m1gC01 C:9-49,C:132-185                 1m1gC02 C:50-131 NusG, domain 2                                                   1m1gC01 C:9-49,C:132-185                              1m1gC03 C:186-247  [code=2.30.30.30, no name defined]         - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee...hhhhhhhhhhhhhhhhhhhh.eeeee...eeeeeeee...eeeeee.....eeeeee....eeeeee....eeeee.....hhhhh........eeee....eeeeeeee......eeeeee..hhhhhhhhhh...eeee.ee..ee...hhhhhhhhhhhhh..............eeee........eeeeeeee....eeeeeeee..eeeeeeee...eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m1g C   5 QVQELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244

Chain D from PDB  Type:PROTEIN  Length:239
 aligned with NUSG_AQUAE | O67757 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:239
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239         
           NUSG_AQUAE    10 EKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
               SCOP domains d1m1gd3 D:10-50,D:132-190                d1m1gd1 D:51-131 N-utilization substance G protein NusG, insert domain           d1m1gd3 D:10-50,D:132-190                                  d1m1gd2 D:191-248                                          SCOP domains
               CATH domains 1m1gD01 D:10-49,D:132-185               1m1gD02 D:50-131 NusG, domain 2                                                   1m1gD01 D:10-49,D:132-185                             1m1gD03 D:186-248  [code=2.30.30.30, no name defined]           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...hhhhhhhhhhhhhhhh.hhh.eeeee...eeeeeeee...eeeeee......eeeee....eeeeee....eeeee....hhhhh.........eeee....eeeeeeee......eeeeee..hhhhhhhhhhh..eeee.ee..ee...hhhhhhhhhhhhhhh............................................................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NUSG      -------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m1g D  10 EKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.940, no name defined] (5)

Aquifex aeolicus. Organism_taxid: 63363. (2)

1a	1m1gA01	A:9-49,A:132-185
1b	1m1gB01	B:9-49,B:132-185
1c	1m1gC01	C:9-49,C:132-185
1d	1m1gD01	D:10-49,D:132-185

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: SH3 type barrels. (648)

Homologous Superfamily: [code=2.30.30.30, no name defined] (111)

Aquifex aeolicus. Organism_taxid: 63363. (1)

2a	1m1gB03	B:186-248
2b	1m1gD03	D:186-248
2c	1m1gA03	A:186-247
2d	1m1gC03	C:186-247

Architecture: Sandwich (5577)

Topology: mini-chromosome maintenance (MCM) complex, domain 2 (4)

Homologous Superfamily: NusG, domain 2 (4)

Aquifex aeolicus. Organism_taxid: 63363. (2)

3a	1m1gA02	A:50-131
3b	1m1gB02	B:50-131
3c	1m1gC02	C:50-131
3d	1m1gD02	D:50-131

(no "Pfam Domain" information available for 1M1G)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (NUSG_AQUAE | O67757)

biological process
	GO:0006354	DNA-templated transcription, elongation	The extension of an RNA molecule after transcription initiation and promoter clearance at a DNA-dependent RNA polymerase promoter by the addition of ribonucleotides catalyzed by an RNA polymerase.
	GO:0006353	DNA-templated transcription, termination	The cellular process that completes DNA-templated transcription; the formation of phosphodiester bonds ceases, the RNA-DNA hybrid dissociates, and RNA polymerase releases the DNA.
	GO:0032784	regulation of DNA-templated transcription, elongation	Any process that modulates the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides catalyzed by a DNA-dependent RNA polymerase.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0031564	transcription antitermination	Regulation of transcription by a mechanism that allows RNA polymerase to continue transcription beyond termination site(s).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1m1g)

	Sites
(no "Sites" information available for 1m1g)

	Cis Peptide Bonds
		Lys A:189 - Pro A:190	[ RasMol ]
		Lys D:189 - Pro D:190	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1m1g
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NUSG_AQUAE \| O67757
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NUSG_AQUAE \| O67757
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NUSG_AQUAE \| O67757	:	1m1h 1npp 1npr

(no "Related Entries Specified in the PDB File" available for 1M1G)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 12)

CATH Domains (3, 12)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File