|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1M1F) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1M1F) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1M1F) |
Exons (0, 0)| (no "Exon" information available for 1M1F) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:107 aligned with PEMK_ECOLX | P13976 from UniProtKB/Swiss-Prot Length:133 Alignment length:110 33 43 53 63 73 83 93 103 113 123 133 PEMK_ECOLX 24 MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT 133 SCOP domains d1m1fa_ A: Kid toxin protein (ParD) SCOP domains CATH domains 1m1fA00 A:1-110 [code=2.30.30.110, no name def ined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1m1f A 1 MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTS---FARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT 110 10 20 30 40 | -| 60 70 80 90 100 110 47 51 Chain B from PDB Type:PROTEIN Length:105 aligned with PEMK_ECOLX | P13976 from UniProtKB/Swiss-Prot Length:133 Alignment length:110 33 43 53 63 73 83 93 103 113 123 133 PEMK_ECOLX 24 MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT 133 SCOP domains d1m1fb_ B: Kid toxin protein (ParD) SCOP domains CATH domains 1m1fB00 B:1-110 [code=2.30.30.110, no name def ined] CATH domains Pfam domains (1) -PemK-1m1fB01 B:2-109 - Pfam domains (1) Pfam domains (2) -PemK-1m1fB02 B:2-109 - Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1m1f B 1 MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTS-----RTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT 110 10 20 30 40 | - | 60 70 80 90 100 110 47 53
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (PEMK_ECOLX | P13976)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|