|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (3, 3)
Asymmetric/Biological Unit
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1LRI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1LRI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1LRI) |
Exons (0, 0)| (no "Exon" information available for 1LRI) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:98 aligned with ELIB_PHYCR | P15570 from UniProtKB/Swiss-Prot Length:118 Alignment length:98 30 40 50 60 70 80 90 100 110 ELIB_PHYCR 21 TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL 118 SCOP domains d1lria_ A: beta-cryptogein SCOP domains CATH domains 1lriA00 A:1-98 Beta-cryptogein CATH domains Pfam domains Elicitin-1lriA01 A:1-96 -- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------- Transcript 1lri A 1 TACTASQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLMCASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL 98 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (ELIB_PHYCR | P15570)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|