|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)
Asymmetric Unit (3, 6)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1LR0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1LR0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1LR0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1LR0) |
Exons (0, 0)| (no "Exon" information available for 1LR0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:126 aligned with TOLA_PSEAE | P50600 from UniProtKB/Swiss-Prot Length:347 Alignment length:126 347 236 246 256 266 276 286 296 306 316 326 336 346| TOLA_PSEAE 227 ALAELLSDTTERQQALADEVGSEVTGSLDDLIVNLVSQQWRRPPSARNGMSVEVLIEMLPDGTITNASVSRSSGDKPFDSSAVAAVRNVGRIPEMQQLPRATFDSLYRQRRIIFKPEDLSL----- - SCOP domains d1lr0a_ A: TolA SCOP domains CATH domains 1lr0A00 A:3-128 [code=3.30.1150.10, no name defined] CATH domains Pfam domains -----------------------------TonB_2-1lr0A01 A:32-107 --------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 1lr0 A 3 ALAELLSDTTERQQALADEVGSEVTGSLDDLIVNLVSQQWRRPPSARNGmSVEVLIEmLPDGTITNASVSRSSGDKPFDSSAVAAVRNVGRIPEmQQLPRATFDSLYRQRRIIFKPEDLSLHHHHH 128 12 22 32 42 52 |62 72 82 92 | 102 112 122 52-MSE 60-MSE 97-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (TOLA_PSEAE | P50600)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|