Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theoretical Model
collapse expand < >
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF VIRAL CASP8 AND FADD-LIKE APOPTOSIS REGULATOR
 
Authors :  R. Sagajkar, A. Muthuvel
Date :  16 Apr 02  (Deposition) - 01 May 02  (Release) - 01 May 02  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  8 Helices , 5 Turns (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Sagajkar, A. Muthuvel
Structure Of Viral Casp8 And Fadd-Like Apoptosis Regulator
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - VIRAL CASP8 AND FADD-LIKE APOPTOSIS REGULATOR
    Chains: A
    Organism Common: VIRUS
    Organism Scientific: EQUINE HERPESVIRUS TYPE 2
    Strain: STRAIN 86/87
    Synonym: V-CFLAR, VIRAL FLICE-INHIBITORY PROTEIN, V-FLIP

 Structural Features

(-) Chains, Units

  
Theoretical Model : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1LGJ)

(-) Sites  (0, 0)

(no "Site" information available for 1LGJ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1LGJ)

(-) Cis Peptide Bonds  (1, 1)

Theoretical Model
No.Residues
1Leu A:154 -Thr A:155

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1LGJ)

(-) PROSITE Motifs  (1, 1)

Theoretical Model (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1DEDPS50168 Death effector domain (DED) profile.CFLA_EHV21-74
92-171		  1-
A:89-168

(-) Exons   (0, 0)

(no "Exon" information available for 1LGJ)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:168
 aligned with CFLA_EHV2 | Q66674 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:168
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163        
            CFLA_EHV2     4 YSMIDTYFSLDEDETETYLYLCRDLLKNKGEFQCTRDAFKFLSDYACLSAANQMELLFRVGRLDLIRRIFGQTWTPDSCPRYYMPICSPFRCLMALVNDFLSDKEVEEMYFLCAPRLESHLEPGSKKSFLRLASLLEDLELLGGDKLTFLRHLLTTIGRADLVKNLQV 171
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE DED  PDB: - UniProt: 1-74                                              -----------------DED  PDB: A:89-168 UniProt: 92-171                                               PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1lgj A   1 YSMIDTYFSLDEDETETYLYLCRDLLKNKGEFQCTRDAFKFLSDYACLSAANQMELLFRVGRLDLIRRIFGQTWTPDSCPRYYMPICSPFRCLMALVNDFLSDKEVEEMYFLCAPRLESHLEPGSKKSFLRLASLLEDLELLGGDKLTFLRHLLTTIGRADLVKNLQV 168
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1LGJ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1LGJ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1LGJ)

(-) Gene Ontology  (4, 4)

Theoretical Model(hide GO term definitions)
Chain A   (CFLA_EHV2 | Q66674)
biological process
    GO:0039526    modulation by virus of host apoptotic process    Any process in which a virus modulates the frequency, rate or extent of apoptosis of infected host cells.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:0019050    suppression by virus of host apoptotic process    Any viral process that inhibits apoptosis of infected host cells, facilitating prolonged cell survival during viral replication.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1lgj)
 
  Sites
(no "Sites" information available for 1lgj)
 
  Cis Peptide Bonds
    Leu A:154 - Thr A:155   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1lgj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CFLA_EHV2 | Q66674
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CFLA_EHV2 | Q66674
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1LGJ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1LGJ)