Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MYCOLIC ACID CYCLOPROPANE SYNTHASE CMAA1 COMPLEXED WITH SAH AND CTAB
 
Authors :  C. -C. Huang, C. V. Smith, W. R. Jacobs Jr. , M. S. Glickman, J. C. Sacchettini, Tb Structural Genomics Consortium (Tbsgc)
Date :  30 Dec 01  (Deposition) - 11 Jan 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Mixed Alpha Beta Fold, Structural Genomics, Psi, Protein Structure Initiative, Tb Structural Genomics Consortium, Tbsgc, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. -C. Huang, C. V. Smith, M. S. Glickman, W. R. Jacobs Jr. , J. C. Sacchettini
Crystal Structures Of Mycolic Acid Cyclopropane Synthases From Mycobacterium Tuberculosis
J. Biol. Chem. V. 277 11559 2002
PubMed-ID: 11756461  |  Reference-DOI: 10.1074/JBC.M111698200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    ChainsA, B, C, D
    EC Number2.1.1.79
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET30B(CMAA1)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePET
    GeneCMAA1
    Organism ScientificMYCOBACTERIUM TUBERCULOSIS
    Organism Taxid1773
    SynonymCYCLOPROPANE FATTY ACID SYNTHASE;
CFA SYNTHASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 48)

Asymmetric Unit (4, 48)
No.NameCountTypeFull Name
116A4Ligand/IonCETYL-TRIMETHYL-AMMONIUM
2CO34Ligand/IonCARBONATE ION
3MSE36Mod. Amino AcidSELENOMETHIONINE
4SAH4Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 1 (4, 12)
No.NameCountTypeFull Name
116A1Ligand/IonCETYL-TRIMETHYL-AMMONIUM
2CO31Ligand/IonCARBONATE ION
3MSE9Mod. Amino AcidSELENOMETHIONINE
4SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 2 (4, 12)
No.NameCountTypeFull Name
116A1Ligand/IonCETYL-TRIMETHYL-AMMONIUM
2CO31Ligand/IonCARBONATE ION
3MSE9Mod. Amino AcidSELENOMETHIONINE
4SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 3 (4, 12)
No.NameCountTypeFull Name
116A1Ligand/IonCETYL-TRIMETHYL-AMMONIUM
2CO31Ligand/IonCARBONATE ION
3MSE9Mod. Amino AcidSELENOMETHIONINE
4SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 4 (4, 12)
No.NameCountTypeFull Name
116A1Ligand/IonCETYL-TRIMETHYL-AMMONIUM
2CO31Ligand/IonCARBONATE ION
3MSE9Mod. Amino AcidSELENOMETHIONINE
4SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:34 , CYS A:35 , GLY A:137 , GLU A:140 , HIS A:167 , ILE A:169 , TYR A:232 , 16A A:1901BINDING SITE FOR RESIDUE CO3 A 1902
02AC2SOFTWARESER B:34 , CYS B:35 , GLY B:137 , GLU B:140 , HIS B:167 , THR B:168 , ILE B:169 , TYR B:232 , VAL B:280 , 16A B:2901BINDING SITE FOR RESIDUE CO3 B 2902
03AC3SOFTWARESER C:34 , CYS C:35 , GLY C:137 , GLU C:140 , HIS C:167 , ILE C:169 , TYR C:232 , 16A C:3901BINDING SITE FOR RESIDUE CO3 C 3902
04AC4SOFTWARESER D:34 , CYS D:35 , GLY D:137 , GLU D:140 , HIS D:167 , ILE D:169 , TYR D:232 , 16A D:4901BINDING SITE FOR RESIDUE CO3 D 4902
05AC5SOFTWAREVAL A:12 , TYR A:16 , THR A:32 , TYR A:33 , SER A:34 , GLY A:72 , GLY A:74 , LEU A:93 , THR A:94 , LEU A:95 , GLN A:99 , GLY A:122 , TRP A:123 , GLU A:124 , ILE A:136 , GLY A:137 , ALA A:138 , HIS A:141 , HOH A:1010 , HOH A:1020 , HOH A:1034 , HOH A:1039 , HOH A:1129 , 16A A:1901BINDING SITE FOR RESIDUE SAH A 1900
06AC6SOFTWAREVAL B:12 , TYR B:16 , THR B:32 , TYR B:33 , SER B:34 , GLY B:72 , GLY B:74 , LEU B:93 , THR B:94 , LEU B:95 , GLN B:99 , GLY B:122 , TRP B:123 , GLU B:124 , ILE B:136 , GLY B:137 , ALA B:138 , HIS B:141 , HOH B:1005 , HOH B:1029 , HOH B:1163 , HOH B:1289 , HOH B:1355 , 16A B:2901BINDING SITE FOR RESIDUE SAH B 2900
07AC7SOFTWAREVAL C:12 , TYR C:16 , THR C:32 , TYR C:33 , SER C:34 , GLY C:72 , GLY C:74 , LEU C:93 , THR C:94 , LEU C:95 , GLN C:99 , GLY C:122 , TRP C:123 , GLU C:124 , ILE C:136 , GLY C:137 , ALA C:138 , HIS C:141 , HOH C:1003 , HOH C:1011 , HOH C:1019 , HOH C:1055 , HOH C:1199 , 16A C:3901BINDING SITE FOR RESIDUE SAH C 3900
08AC8SOFTWAREVAL D:12 , TYR D:16 , THR D:32 , TYR D:33 , SER D:34 , GLY D:72 , GLY D:74 , THR D:94 , LEU D:95 , SER D:96 , GLN D:99 , GLY D:122 , TRP D:123 , GLU D:124 , ILE D:136 , GLY D:137 , ALA D:138 , HIS D:141 , HOH D:1052 , HOH D:1063 , HOH D:1099 , HOH D:1186 , HOH D:1226 , HOH D:1578BINDING SITE FOR RESIDUE SAH D 4900
09AC9SOFTWARETYR A:16 , TYR A:33 , GLY A:137 , GLU A:140 , ILE A:169 , LEU A:192 , ILE A:195 , PHE A:200 , GLY A:203 , ARG A:204 , TYR A:232 , CYS A:269 , SAH A:1900 , CO3 A:1902BINDING SITE FOR RESIDUE 16A A 1901
10BC1SOFTWARETYR B:16 , TYR B:33 , GLY B:137 , GLU B:140 , ILE B:169 , PHE B:200 , GLY B:203 , ARG B:204 , LEU B:205 , TYR B:232 , CYS B:269 , ILE B:278 , SAH B:2900 , CO3 B:2902BINDING SITE FOR RESIDUE 16A B 2901
11BC2SOFTWARETYR C:16 , TYR C:33 , GLY C:137 , GLU C:140 , HIS C:141 , ILE C:169 , LEU C:192 , ILE C:195 , VAL C:196 , PHE C:200 , GLY C:203 , ARG C:204 , TYR C:232 , CYS C:269 , SAH C:3900 , CO3 C:3902BINDING SITE FOR RESIDUE 16A C 3901
12BC3SOFTWARETYR D:16 , TYR D:33 , GLY D:137 , GLU D:140 , HIS D:141 , ILE D:169 , ILE D:195 , PHE D:200 , GLY D:203 , ARG D:204 , LEU D:205 , TYR D:232 , CYS D:269 , CO3 D:4902BINDING SITE FOR RESIDUE 16A D 4901

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1KPG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1KPG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KPG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1KPG)

(-) Exons   (0, 0)

(no "Exon" information available for 1KPG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:285
 aligned with CMAS1_MYCTA | A5U866 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:285
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282     
          CMAS1_MYCTA     3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpga_ A: CmaA1                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1kpgA00 A:3-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhh...hhhhhhhhhhhhh....eeeeeeeee.hhhhhh.....hhhhhhhhhhhhhhhh.......hhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg A   3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    12        22        32        42|       52        62   |    72      ||82        92       102       112       122       132       142       152       162 |     172       182 |     192       202       212       222       232       242       252       262|      272       282     
                                                                   43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                        80-MSE                                                                                                                                                                                                           

Chain A from PDB  Type:PROTEIN  Length:285
 aligned with CMAS1_MYCTO | P9WPB6 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:285
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282     
          CMAS1_MYCTO     3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQDIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpga_ A: CmaA1                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1kpgA00 A:3-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhh...hhhhhhhhhhhhh....eeeeeeeee.hhhhhh.....hhhhhhhhhhhhhhhh.......hhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg A   3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    12        22        32        42|       52        62   |    72      ||82        92       102       112       122       132       142       152       162 |     172       182 |     192       202       212       222       232       242       252       262|      272       282     
                                                                   43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                        80-MSE                                                                                                                                                                                                           

Chain A from PDB  Type:PROTEIN  Length:285
 aligned with CMAS1_MYCTU | P9WPB7 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:285
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282     
          CMAS1_MYCTU     3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpga_ A: CmaA1                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1kpgA00 A:3-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhh...hhhhhhhhhhhhh....eeeeeeeee.hhhhhh.....hhhhhhhhhhhhhhhh.......hhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg A   3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    12        22        32        42|       52        62   |    72      ||82        92       102       112       122       132       142       152       162 |     172       182 |     192       202       212       222       232       242       252       262|      272       282     
                                                                   43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                        80-MSE                                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:284
 aligned with CMAS1_MYCTA | A5U866 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:284
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283    
          CMAS1_MYCTA     4 ELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgb_ B: CmaA1                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1kpgB00 B:4-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg B   4 ELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    13        23        33        43        53        63  |     73     || 83        93       103       113       123       133       143       153       163|      173       183|      193       203      |213       223       233       243       253       263       273       283    
                                                                  43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                       80-MSE                                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:284
 aligned with CMAS1_MYCTO | P9WPB6 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:284
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283    
          CMAS1_MYCTO     4 ELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQDIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgb_ B: CmaA1                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1kpgB00 B:4-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg B   4 ELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    13        23        33        43        53        63  |     73     || 83        93       103       113       123       133       143       153       163|      173       183|      193       203      |213       223       233       243       253       263       273       283    
                                                                  43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                       80-MSE                                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:284
 aligned with CMAS1_MYCTU | P9WPB7 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:284
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283    
          CMAS1_MYCTU     4 ELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgb_ B: CmaA1                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1kpgB00 B:4-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg B   4 ELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    13        23        33        43        53        63  |     73     || 83        93       103       113       123       133       143       153       163|      173       183|      193       203      |213       223       233       243       253       263       273       283    
                                                                  43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                       80-MSE                                                                                                                                                                                                           

Chain C from PDB  Type:PROTEIN  Length:285
 aligned with CMAS1_MYCTA | A5U866 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:285
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282     
          CMAS1_MYCTA     3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgc_ C: CmaA1                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1kpgC00 C:3-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..ee...eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg C   3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    12        22        32        42|       52        62   |    72      ||82        92       102       112       122       132       142       152       162 |     172       182 |     192       202       212       222       232       242       252       262|      272       282     
                                                                   43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                        80-MSE                                                                                                                                                                                                           

Chain C from PDB  Type:PROTEIN  Length:285
 aligned with CMAS1_MYCTO | P9WPB6 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:285
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282     
          CMAS1_MYCTO     3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQDIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgc_ C: CmaA1                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1kpgC00 C:3-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..ee...eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg C   3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    12        22        32        42|       52        62   |    72      ||82        92       102       112       122       132       142       152       162 |     172       182 |     192       202       212       222       232       242       252       262|      272       282     
                                                                   43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                        80-MSE                                                                                                                                                                                                           

Chain C from PDB  Type:PROTEIN  Length:285
 aligned with CMAS1_MYCTU | P9WPB7 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:285
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282     
          CMAS1_MYCTU     3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgc_ C: CmaA1                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1kpgC00 C:3-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh....hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..ee...eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg C   3 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    12        22        32        42|       52        62   |    72      ||82        92       102       112       122       132       142       152       162 |     172       182 |     192       202       212       222       232       242       252       262|      272       282     
                                                                   43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                        80-MSE                                                                                                                                                                                                           

Chain D from PDB  Type:PROTEIN  Length:283
 aligned with CMAS1_MYCTA | A5U866 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:283
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284   
          CMAS1_MYCTA     5 LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgd_ D: CmaA1                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1kpgD00 D:5-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                 CATH domains
           Pfam domains (1) CMAS-1kpgD01 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (1)
           Pfam domains (2) CMAS-1kpgD02 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (2)
           Pfam domains (3) CMAS-1kpgD03 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (3)
           Pfam domains (4) CMAS-1kpgD04 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (4)
         Sec.struct. author ...hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhh...hhhhhhhhhhhhh....eeeeeeeee.hhhhhhhh...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg D   5 LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    14        24        34        44        54        64 |      74    ||  84        94       104       114       124       134       144       154       164       174       184       194       204     | 214       224       234       244       254       264       274       284   
                                                                 43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                      80-MSE                                                                                                                                                                                                           

Chain D from PDB  Type:PROTEIN  Length:283
 aligned with CMAS1_MYCTO | P9WPB6 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:283
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284   
          CMAS1_MYCTO     5 LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQDIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgd_ D: CmaA1                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1kpgD00 D:5-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                 CATH domains
           Pfam domains (1) CMAS-1kpgD01 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (1)
           Pfam domains (2) CMAS-1kpgD02 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (2)
           Pfam domains (3) CMAS-1kpgD03 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (3)
           Pfam domains (4) CMAS-1kpgD04 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (4)
         Sec.struct. author ...hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhh...hhhhhhhhhhhhh....eeeeeeeee.hhhhhhhh...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg D   5 LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    14        24        34        44        54        64 |      74    ||  84        94       104       114       124       134       144       154       164       174       184       194       204     | 214       224       234       244       254       264       274       284   
                                                                 43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                      80-MSE                                                                                                                                                                                                           

Chain D from PDB  Type:PROTEIN  Length:283
 aligned with CMAS1_MYCTU | P9WPB7 from UniProtKB/Swiss-Prot  Length:287

    Alignment length:283
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284   
          CMAS1_MYCTU     5 LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK 287
               SCOP domains d1kpgd_ D: CmaA1                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1kpgD00 D:5-287 Vaccinia Virus protein VP39                                                                                                                                                                                                                                                 CATH domains
           Pfam domains (1) CMAS-1kpgD01 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (1)
           Pfam domains (2) CMAS-1kpgD02 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (2)
           Pfam domains (3) CMAS-1kpgD03 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (3)
           Pfam domains (4) CMAS-1kpgD04 D:5-283                                                                                                                                                                                                                                                                   ---- Pfam domains (4)
         Sec.struct. author ...hhhhhhhhhh.hhhhhh...................hhhhhhhhhhhhhhh........eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh......eeeee.hhhhh.....eeeee.hhhhh...hhhhhhhhhhhhh....eeeeeeeee.hhhhhhhh...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1kpg D   5 LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDmTLQEAQIAKIDLALGKLGLQPGmTLLDVGCGWGATmmRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVmLLHTITGLHPKEIHERGLPmSFTFARFLKFIVTEIFPGGRLPSIPmVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYmKYLTGCAEmFRIGYIDVNQFTCQK 287
                                    14        24        34        44        54        64 |      74    ||  84        94       104       114       124       134       144       154       164       174       184       194       204     | 214       224       234       244       254       264       274       284   
                                                                 43-MSE                 66-MSE       79-MSE                                                                              164-MSE             184-MSE                   210-MSE                                              263-MSE  272-MSE           
                                                                                                      80-MSE                                                                                                                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (10, 24)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (CMAS1_MYCTA | A5U866)
molecular function
    GO:0008825    cyclopropane-fatty-acyl-phospholipid synthase activity    Catalysis of the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008610    lipid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A,B,C,D   (CMAS1_MYCTU | P9WPB7)
molecular function
    GO:0008825    cyclopropane-fatty-acyl-phospholipid synthase activity    Catalysis of the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0046500    S-adenosylmethionine metabolic process    The chemical reactions and pathways involving S-adenosylmethionine, S-(5'-adenosyl)-L-methionine, an important intermediate in one-carbon metabolism.
    GO:0008610    lipid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0071768    mycolic acid biosynthetic process    The chemical reactions and pathways resulting in the formation of mycolic acids, beta-hydroxy fatty acids with a long alpha-alkyl side chain.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B,C,D   (CMAS1_MYCTO | P9WPB6)
molecular function
    GO:0008825    cyclopropane-fatty-acyl-phospholipid synthase activity    Catalysis of the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008610    lipid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    16A  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1kpg)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1kpg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CMAS1_MYCTA | A5U866
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CMAS1_MYCTO | P9WPB6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CMAS1_MYCTU | P9WPB7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.79
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CMAS1_MYCTA | A5U866
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CMAS1_MYCTO | P9WPB6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CMAS1_MYCTU | P9WPB7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CMAS1_MYCTA | A5U8661kp9 1kph
        CMAS1_MYCTO | P9WPB61kp9 1kph
        CMAS1_MYCTU | P9WPB71kp9 1kph

(-) Related Entries Specified in the PDB File

1kp9
1kph
1kpi RELATED ID: RV3392C RELATED DB: TARGETDB