Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HEX1
 
Authors :  P. Yuan, K. Swaminathan
Date :  30 Nov 01  (Deposition) - 30 Nov 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.78
Chains :  Asym./Biol. Unit :  A
Keywords :  Hex1, Neurospora Crassa, Membrane Sealing, Peroxisomal Target, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Yuan, G. Jedd, D. Kumaran, S. Swaminathan, H. Shio, D. Hewitt, N. -H. Chua, K. Swaminathan
A Hex-1 Crystal Lattice Required For Woronin Body Function In Neurospora Crassa
Nat. Struct. Biol. V. 10 264 2003
PubMed-ID: 12640443  |  Reference-DOI: 10.1038/NSB910
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HEX1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Gene: HEX1 (1-176)
    Expression System Plasmid: PGEX61
    Expression System Strain: BL21(DE3)LYS-S
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: NEUROSPORA CRASSA
    Organism Taxid: 5141
    Synonym: WORONIN BODY MAJOR PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1KHI)

(-) Sites  (0, 0)

(no "Site" information available for 1KHI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1KHI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1KHI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1KHI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1KHI)

(-) Exons   (0, 0)

(no "Exon" information available for 1KHI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:147
 aligned with HEX1_NEUCR | P87252 from UniProtKB/Swiss-Prot  Length:176

    Alignment length:147
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       
           HEX1_NEUCR    27 GSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDHGREMAVDMKVVHG 173
               SCOP domains d1khia1 A:27-102 Woronin body major protein (Hex1)                          d1khia2 A:103-173 C-terminal domain of eIF5a homologue (Hex1)           SCOP domains
               CATH domains 1khiA01 A:27-101  [code=2.30.30.30, no name defined]                       1khiA02 A:102-173 Nucleic acid-binding proteins                          CATH domains
               Pfam domains ----------------------------------------------------------------------------eIF-5a-1khiA01 A:103-169                                           ---- Pfam domains
         Sec.struct. author .....eeeee.hhh....eeee..eeeeeeeeee......eeeeeee.....eeeee..ee.......eeeeeee..eeeeeeeee..eeeee.....eeeeee.....hhhhhhhhhhhhhhh.eeeeeeee..eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1khi A  27 GSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDHGREMAVDMKVVHG 173
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: OB (224)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (HEX1_NEUCR | P87252)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0043022    ribosome binding    Interacting selectively and non-covalently with any part of a ribosome.
    GO:0003746    translation elongation factor activity    Functions in chain elongation during polypeptide synthesis at the ribosome.
biological process
    GO:0045901    positive regulation of translational elongation    Any process that activates or increases the frequency, rate or extent of translational elongation.
    GO:0045905    positive regulation of translational termination    Any process that activates or increases the frequency, rate or extent of translational termination.
    GO:0006452    translational frameshifting    A mechanism whereby different proteins may result from a single mRNA molecule, due to a change in the parsing of three nucleotides per codon relative to an initiating AUG codon.
cellular component
    GO:0005777    peroxisome    A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1khi)
 
  Sites
(no "Sites" information available for 1khi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1khi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1khi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HEX1_NEUCR | P87252
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HEX1_NEUCR | P87252
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1KHI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1KHI)