Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE DNA-BINDING DOMAIN OF INTERLEUKIN ENHANCER BINDING FACTOR
 
Authors :  W. J. Chuang, P. P. Liu, C. Li, Y. H. Hsieh, S. W. Chen, S. H. Chen, W. Y. Jeng
Date :  08 Sep 01  (Deposition) - 11 Mar 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Dna-Binding Domain, Winged Helix, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. P. Liu, Y. C. Chen, C. Li, Y. H. Hsieh, S. W. Chen, S. H. Chen, W. Y. Jeng, W. J. Chuang
Solution Structure Of The Dna-Binding Domain Of Interleukin Enhancer Binding Factor 1 (Foxk1A)
Proteins: V. 49 543 2002 Struct. , Funct. , Genet.
PubMed-ID: 12402362  |  Reference-DOI: 10.1002/PROT.10227
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INTERLEUKIN ENHANCER BINDING FACTOR
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PET21A
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Fragment: DNA-BINDING DOMAIN
    Gene: ILF-1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: ILF-1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JXS)

(-) Sites  (0, 0)

(no "Site" information available for 1JXS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JXS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1JXS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JXS)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FORK_HEAD_1PS00657 Fork head domain signature 1.FOXK2_HUMAN258-271  1A:3-16
2FORK_HEAD_3PS50039 Fork head domain profile.FOXK2_HUMAN258-353  1A:3-98
3FORK_HEAD_2PS00658 Fork head domain signature 2.FOXK2_HUMAN302-308  1A:47-53

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003352551aENSE00002142812chr17:80477591-80478183593FOXK2_HUMAN1-1401400--
1.3ENST000003352553ENSE00001282714chr17:80521230-80521424195FOXK2_HUMAN140-205660--
1.4ENST000003352554ENSE00000949826chr17:80525930-80526077148FOXK2_HUMAN205-254500--
1.5aENST000003352555aENSE00001334520chr17:80529600-80529746147FOXK2_HUMAN255-303491A:1-4848
1.6bENST000003352556bENSE00001112229chr17:80540617-80540810194FOXK2_HUMAN304-368651A:49-9850
1.7ENST000003352557ENSE00001112228chr17:80541889-80542064176FOXK2_HUMAN368-427600--
1.8ENST000003352558ENSE00001112227chr17:80543780-80544076297FOXK2_HUMAN427-5261000--
1.9ENST000003352559ENSE00001112230chr17:80544939-80545148210FOXK2_HUMAN526-596710--
1.13cENST0000033525513cENSE00001362311chr17:80559179-805624833305FOXK2_HUMAN596-660650--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:98
 aligned with FOXK2_HUMAN | Q01167 from UniProtKB/Swiss-Prot  Length:660

    Alignment length:98
                                   265       275       285       295       305       315       325       335       345        
          FOXK2_HUMAN   256 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR 353
               SCOP domains d1jxsa_ A: Interleukin enhancer binding factor                                                     SCOP domains
               CATH domains 1jxsA00 A:1-98 'winged helix' repressor DNA binding domain                                         CATH domains
               Pfam domains --Fork_head-1jxsA01 A:3-98                                                                         Pfam domains
         Sec.struct. author ........hhhhhhhhhh....eehhhhhhhhhhhhh.........hhhhhhhhhhhh..eeee...........eeee...hhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --FORK_HEAD_1   ------------------------------FORK_HE--------------------------------------------- PROSITE (1)
                PROSITE (2) --FORK_HEAD_3  PDB: A:3-98 UniProt: 258-353                                                        PROSITE (2)
               Transcript 1 Exon 1.5a  PDB: A:1-48 UniProt: 255-303         Exon 1.6b  PDB: A:49-98 UniProt: 304-368           Transcript 1
                 1jxs A   1 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR  98
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Fork_head] (7)

(-) Gene Ontology  (16, 16)

NMR Structure(hide GO term definitions)
Chain A   (FOXK2_HUMAN | Q01167)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0001077    transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
biological process
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jxs)
 
  Sites
(no "Sites" information available for 1jxs)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jxs)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jxs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FOXK2_HUMAN | Q01167
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FOXK2_HUMAN | Q01167
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FOXK2_HUMAN | Q01167: 2c6y

(-) Related Entries Specified in the PDB File

4829 1H, 15N AND 13C RESONANCE ASSIGNMENTS FOR THE DNA-BINDING DOMAIN OF INTERLEUKIN ENHANCER BINDING FACTOR