Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BITISCETIN, A VON WILLEBAND FACTOR-DEPENDENT PLATELET AGGREGATION INDUCER.
 
Authors :  S. Hirotsu, H. Mizuno, K. Fukuda, M. C. Qi, T. Matsui, J. Hamako, T. Morita, K. Titani
Date :  04 Sep 01  (Deposition) - 28 Nov 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Domain Swapping, C-Type Lectin, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Hirotsu, H. Mizuno, K. Fukuda, M. C. Qi, T. Matsui, J. Hamako, T. Morita, K. Titani
Crystal Structure Of Bitiscetin, A Von Willebrand Factor-Dependent Platelet Aggregation Inducer.
Biochemistry V. 40 13592 2001
PubMed-ID: 11695907  |  Reference-DOI: 10.1021/BI0114933
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BITISCETIN
    ChainsA
    Organism CommonPUFF ADDER
    Organism ScientificBITIS ARIETANS
    Organism Taxid8692
    SecretionVENOM
    SynonymBITISCETIN ALPHA CHAIN
 
Molecule 2 - PLATELET AGGREGATION INDUCER
    ChainsB
    Organism CommonPUFF ADDER
    Organism ScientificBITIS ARIETANS
    Organism Taxid8692
    SecretionVENOM
    SynonymBITISCETIN BETA CHAIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JWI)

(-) Sites  (0, 0)

(no "Site" information available for 1JWI)

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:4 -A:15
2A:32 -A:125
3A:79 -B:77
4A:100 -A:117
5B:4 -B:15
6B:32 -B:121
7B:98 -B:113

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1JWI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JWI)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1C_TYPE_LECTIN_2PS50041 C-type lectin domain profile.SLB_BITAR11-122  1B:11-122
SLA_BITAR11-126  1A:11-126

(-) Exons   (0, 0)

(no "Exon" information available for 1JWI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:122
 aligned with SLA_BITAR | Q7LZK5 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:124
                                    13        23        33        43        53        63        73        83        93       103       113       123    
            SLA_BITAR     4 CLPDWSSYKGHCYKVFKKVGTWEDAEKFCVENSGHLASIDSKEEADFVTKLASQTLTKFVYDAWIGLRDESKTQQCSPQWTDGSSVVYENVDEPTKCFGLDVHTEYRTWTDLPCGEKNPFICKS 127
               SCOP domains d1jwia_ A: Snake coagglutinin alpha chain                                                                                    SCOP domains
               CATH domains 1jwiA00 A:4-127 Mannose-Binding Protein A, subunit A                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..eeeeeeeeeehhhhhhhhhhhh..ee....hhhhhhhhhhhhhhhh--....eeeeeee...........................eeee.hhhh...eeee.....eeeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------C_TYPE_LECTIN_2  PDB: A:11-126 UniProt: 11-126                                                                      - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jwi A   4 CLPDWSSYKGHCYKVFKKVGTWEDAEKFCVENSGHLASIDSKEEADFVTKLASQTL--FVYDAWIGLRDESKTQQCSPQWTDGSSVVYENVDEPTKCFGLDVHTEYRTWTDLPCGEKNPFICKS 127
                                    13        23        33        43        53     |  63        73        83        93       103       113       123    
                                                                                  59 62                                                                 

Chain B from PDB  Type:PROTEIN  Length:123
 aligned with SLB_BITAR | Q7LZK8 from UniProtKB/Swiss-Prot  Length:125

    Alignment length:123
                                    12        22        32        42        52        62        72        82        92       102       112       122   
            SLB_BITAR     3 GCLPDWSSYKGHCYKVFKVEKTWADAEKFCKELVNGGHLMSVNSREEGEFISKLALEKMRIVLVWIGLSHFWRICPLRWTDGARLDYRALSDEPICFVAESFHNKWIQWTCNRKKSFVCKYRV 125
               SCOP domains d1jwib_ B: Snake coagglutinin beta chain                                                                                    SCOP domains
               CATH domains 1jwiB00 B:3-125 Mannose-Binding Protein A, subunit A                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeeeeeeeeehhhhhhhhhhhhh...ee....hhhhhhhhhhhhhhh....eeeeeeeehhhhh.eee...............eeeeee.....eeeee....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------C_TYPE_LECTIN_2  PDB: B:11-122 UniProt: 11-122                                                                  --- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 1jwi B   3 GCLPDWSSYKGHCYKVFKVEKTWADAEKFCKELVNGGHLMSVNSREEGEFISKLALEKMRIVLVWIGLSHFWRICPLRWTDGARLDYRALSDEPICFVAESFHNKWIQWTCNRKKSFVCKYRV 125
                                    12        22        32        42        52        62        72        82        92       102       112       122   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1JWI)

(-) Gene Ontology  (1, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (SLA_BITAR | Q7LZK5)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B   (SLB_BITAR | Q7LZK8)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jwi)
 
  Sites
(no "Sites" information available for 1jwi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jwi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jwi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SLA_BITAR | Q7LZK5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SLB_BITAR | Q7LZK8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SLA_BITAR | Q7LZK5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SLB_BITAR | Q7LZK8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SLA_BITAR | Q7LZK51uex
        SLB_BITAR | Q7LZK81uex

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JWI)