1JR8 - JenaLib

Title :   CRYSTAL STRUCTURE OF ERV2P

Authors :   E. Gross, C. S. Sevier, A. Vala, C. A. Kaiser, D. Fass

Date :   13 Aug 01 (Deposition) - 28 Dec 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.50

Chains :   Asym./Biol. Unit : A,B

Keywords :   Fad, Sulfhydryl Oxidase, Helical Bundle, Cxxc, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Gross, C. S. Sevier, A. Vala, C. A. Kaiser, D. Fass
A New Fad-Binding Fold And Intersubunit Disulfide Shuttle In The Thiol Oxidase Erv2P.
Nat. Struct. Biol. V. 9 61 2002
PubMed-ID: 11740506 | Reference-DOI: 10.1038/NSB740
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS B:11 , GLY B:15 , ARG B:16 , SER B:18 , TRP B:19 , HIS B:23 , TYR B:52 , CYS B:57 , HIS B:60 , PHE B:61 , CYS B:83 , HIS B:86 , ASN B:87 , VAL B:89 , ASN B:90 , LEU B:93 , LYS B:95 , TYR B:98 , ILE B:103 , TYR B:107 , HOH B:343 , HOH B:346 , HOH B:377 , HOH B:394 , HOH B:398 , HOH B:419 , HOH B:427	BINDING SITE FOR RESIDUE FAD B 334
2	AC2	SOFTWARE	LYS A:11 , LYS A:12 , GLY A:15 , ARG A:16 , SER A:18 , TRP A:19 , HIS A:23 , TYR A:48 , TYR A:52 , CYS A:57 , HIS A:60 , PHE A:61 , CYS A:83 , HIS A:86 , ASN A:87 , VAL A:89 , ASN A:90 , LEU A:93 , LYS A:95 , TYR A:98 , ILE A:103 , TYR A:107 , HOH A:344 , HOH A:345 , HOH A:391 , HOH A:392 , HOH A:393 , HOH A:402 , HOH A:441 , HOH A:464	BINDING SITE FOR RESIDUE FAD A 335

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (1, 2)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:105
 aligned with ERV2_YEAST | Q12284 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:105
                                    83        93       103       113       123       133       143       153       163       173     
           ERV2_YEAST    74 DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGC 178
               SCOP domains d1jr8a_ A: Thiol oxidase Erv2p                                                                            SCOP domains
               CATH domains 1jr8A00 A:7-111  [code=1.20.120.310, no name defined]                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh........hhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:7-111 UniProt: 1-196 [INCOMPLETE]                                                        Transcript 1
                 1jr8 A   7 DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGC 111
                                    16        26        36        46        56        66        76        86        96       106

Chain B from PDB  Type:PROTEIN  Length:105
 aligned with ERV2_YEAST | Q12284 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:105
                                    84        94       104       114       124       134       144       154       164       174     
           ERV2_YEAST    75 DKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGCS 179
               SCOP domains d1jr8b_ B: Thiol oxidase Erv2p                                                                            SCOP domains
               CATH domains 1jr8B00 B:8-112  [code=1.20.120.310, no name defined]                                                     CATH domains
           Pfam domains (1) --------Evr1_Alr-1jr8B01 B:16-109                                                                     --- Pfam domains (1)
           Pfam domains (2) --------Evr1_Alr-1jr8B02 B:16-109                                                                     --- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:8-112 UniProt: 1-196 [INCOMPLETE]                                                        Transcript 1
                 1jr8 B   8 DKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGCS 112
                                    17        27        37        47        57        67        77        87        97       107

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (ERV2_YEAST | Q12284)

molecular function
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0003756	protein disulfide isomerase activity	Catalysis of the rearrangement of both intrachain and interchain disulfide bonds in proteins.
	GO:0016972	thiol oxidase activity	Catalysis of the reaction: 4 R'C(R)SH + O2 = 2 R'C(R)S-S(R)CR' + 2 H2O.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0030176	integral component of endoplasmic reticulum membrane	The component of the endoplasmic reticulum membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jr8)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1jr8
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ERV2_YEAST \| Q12284
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description