1JP4 - JenaLib

Title :   CRYSTAL STRUCTURE OF AN ENZYME DISPLAYING BOTH INOSITOL-POLYPHOSPHATE 1-PHOSPHATASE AND 3'-PHOSPHOADENOSINE-5'-PHOSPHATE PHOSPHATASE ACTIVITIES

Authors :   S. Patel, L. Yenush, P. L. Rodriguez, R. Serrano, T. L. Blundell

Date :   01 Aug 01 (Deposition) - 08 Aug 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.69

Chains :   Asym./Biol. Unit : A

Keywords :   Protein-Product Complex, Sugar Nucleotidase Fold, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Patel, L. Yenush, P. L. Rodriguez, R. Serrano, T. L. Blundell
Crystal Structure Of An Enzyme Displaying Both Inositol-Polyphosphate-1-Phosphatase And 3'-Phosphoadenosine-5'-Phosphate Phosphatase Activities: A Novel Target Of Lithium Therapy.
J. Mol. Biol. V. 315 677 2002
PubMed-ID: 11812139 | Reference-DOI: 10.1006/JMBI.2001.5271
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 6)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:51 , GLU A:74 , ASP A:117 , VAL A:119 , ASP A:120 , GLY A:121 , THR A:122 , AMP A:601 , MG A:701 , MG A:702 , MG A:703 , HOH A:812 , HOH A:840 , HOH A:929 , HOH A:1216 , HOH A:1218 , HOH A:1219	BINDING SITE FOR RESIDUE PO4 A 501
2	AC2	SOFTWARE	ASP A:117 , ASP A:120 , ASP A:247 , PO4 A:501 , AMP A:601 , MG A:702 , HOH A:840	BINDING SITE FOR RESIDUE MG A 701
3	AC3	SOFTWARE	GLU A:74 , ASP A:117 , VAL A:119 , PO4 A:501 , MG A:701 , HOH A:811	BINDING SITE FOR RESIDUE MG A 702
4	AC4	SOFTWARE	GLU A:74 , PO4 A:501 , HOH A:929 , HOH A:1216 , HOH A:1217 , HOH A:1218 , HOH A:1219	BINDING SITE FOR RESIDUE MG A 703
5	AC5	SOFTWARE	ASP A:120 , THR A:195 , HIS A:198 , GLY A:219 , GLY A:220 , LYS A:224 , PHE A:238 , GLY A:242 , CYS A:243 , ASP A:247 , PO4 A:501 , MG A:701 , HOH A:828 , HOH A:840 , HOH A:853 , HOH A:900 , HOH A:929	BINDING SITE FOR RESIDUE AMP A 601
6	AC6	SOFTWARE	GLN A:55 , CYS A:59 , ILE A:71 , GLY A:73 , HOH A:916 , HOH A:1117	BINDING SITE FOR RESIDUE BME A 801

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (8, 8)

Asymmetric/Biological Unit (8, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000003249	1	ENSRNOE00000022972	chr13:101351124-101351231	108	BPNT1_RAT	1-36	36	1	A:5-36	32
1.2	ENSRNOT00000003249	2	ENSRNOE00000022988	chr13:101354970-101355082	113	BPNT1_RAT	37-74	38	1	A:37-74	38
1.3	ENSRNOT00000003249	3	ENSRNOE00000354877	chr13:101355110-101355140	31	BPNT1_RAT	74-84	11	1	A:74-84 (gaps)	11
1.4	ENSRNOT00000003249	4	ENSRNOE00000434617	chr13:101357260-101357272	13	BPNT1_RAT	85-89	5	1	A:85-89	5
1.5	ENSRNOT00000003249	5	ENSRNOE00000023022	chr13:101358488-101358579	92	BPNT1_RAT	89-119	31	1	A:89-119	31
1.6	ENSRNOT00000003249	6	ENSRNOE00000023036	chr13:101362075-101362272	198	BPNT1_RAT	120-185	66	1	A:120-185	66
1.7	ENSRNOT00000003249	7	ENSRNOE00000023055	chr13:101363822-101363927	106	BPNT1_RAT	186-221	36	1	A:186-221	36
1.8	ENSRNOT00000003249	8	ENSRNOE00000023075	chr13:101366465-101367549	1085	BPNT1_RAT	221-269	49	1	A:221-269	49

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with BPNT1_RAT | Q9Z1N4 from UniProtKB/Swiss-Prot  Length:308

    Alignment length:304
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304    
            BPNT1_RAT     5 HNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPGEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP 308
               SCOP domains d1jp4a_ A: PIPase                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1jp4A01 A:5-179 Fructose-1,6-Bisphosphatase, subunit A, domain 1                                                                                                               1jp4A02 A:180-308  [code=3.40.190.80, no name defined]                                                                            CATH domains
               Pfam domains ---Inositol_P-1jp4A01 A:8-303                                                                                                                                                                                                                                                                              ----- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..eeehhhhhhhhhhhhhhhhhhh...eeee.....--..hhhhh....hhhhhh...hhhhh..hhh.eeeeeeeeehhhhhhh.hhhhheeeeeeee..eeeeeeeee..............eeeeee...eee............eeeee....hhhhhhhhhh....eeeee.hhhhhhhhhhh....eeee.....hhhhhhhhhhhhhhh..eee....................eeee..hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------IMP_1        -----------------------------------------------------------------------------------------------------------------------IMP_2          ------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:5-36           Exon 1.2  PDB: A:37-74 UniProt: 37-74 ----------1.4  ------------------------------Exon 1.6  PDB: A:120-185 UniProt: 120-185                         Exon 1.7  PDB: A:186-221            --------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.3   ----Exon 1.5  PDB: A:89-119        -----------------------------------------------------------------------------------------------------Exon 1.8  PDB: A:221-269 UniProt: 221-269        --------------------------------------- Transcript 1 (2)
                 1jp4 A   5 HNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLP--EVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP 308
                                    14        24        34        44        54        64        74   |  | 84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304    
                                                                                                    78 81

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (2, 2)

Pfam Domains (1, 1)

Gene Ontology (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (BPNT1_RAT | Q9Z1N4)

molecular function
	GO:0008441	3'(2'),5'-bisphosphate nucleotidase activity	Catalysis of the reaction: adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004441	inositol-1,4-bisphosphate 1-phosphatase activity	Catalysis of the reaction: 1D-myo-inositol 1,4-bisphosphate + H2O = 1D-myo-inositol 4-phosphate + phosphate.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0008150	biological_process	Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0006139	nucleobase-containing compound metabolic process	Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AMP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		BME	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jp4)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1jp4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BPNT1_RAT \| Q9Z1N4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.57
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	3.1.3.7
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description