Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF SARCOLIPIN
 
Authors :  G. Veglia, A. Mascioni
Date :  14 Jun 01  (Deposition) - 13 Feb 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (16x)
Keywords :  Helix, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Mascioni, C. Karim, G. Barany, D. D. Thomas, G. Veglia
Structure And Orientation Of Sarcolipin In Lipid Environments.
Biochemistry V. 41 475 2002
PubMed-ID: 11781085  |  Reference-DOI: 10.1021/BI011243M
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SARCOLIPIN
    Chains: A
    Engineered: YES
    Other Details: THIS SEQUENCE OCCURS NATURALLY IN HOMO SAPIENS (HUMANS).
    Synthetic: YES

 Structural Features

(-) Chains, Units

  
NMR Structure (16x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1JDM)

(-) Sites  (0, 0)

(no "Site" information available for 1JDM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1JDM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1JDM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1JDM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1JDM)

(-) Exons   (1, 1)

NMR Structure (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2bENST000003059912bENSE00001156474chr11:107582787-10758268999SARCO_HUMAN-00--
1.3bENST000003059913bENSE00001132681chr11:107578731-107578109623SARCO_HUMAN1-56561A:1-3131

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:31
 aligned with SARCO_HUMAN | O00631 from UniProtKB/Swiss-Prot  Length:31

    Alignment length:31
                                    10        20        30 
           SARCO_HUMAN    1 MGINTRELFLNFTIVLITVILMWLLVRSYQY 31
               SCOP domains d1jdma_ A: Sarcolipin           SCOP domains
               CATH domains ------------------------------- CATH domains
               Pfam domains Sarcolipin-1jdmA01 A:1-31       Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
               Transcript 1 Exon 1.3b  PDB: A:1-31          Transcript 1
                  1jdm A  1 MGINTRELFLNFTIVLITVILMWLLVRSYQY 31
                                    10        20        30
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1JDM)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Sarcolipin] (1)

(-) Gene Ontology  (21, 21)

NMR Structure(hide GO term definitions)
Chain A   (SARCO_HUMAN | O00631)
molecular function
    GO:0051117    ATPase binding    Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
    GO:0004857    enzyme inhibitor activity    Binds to and stops, prevents or reduces the activity of an enzyme.
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006816    calcium ion transport    The directed movement of calcium (Ca) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:1901877    negative regulation of calcium ion binding    Any process that stops, prevents or reduces the frequency, rate or extent of calcium ion binding.
    GO:0090281    negative regulation of calcium ion import    Any process that decreases the rate, frequency, or extent of the directed movement of calcium ions into a cell or organelle.
    GO:1901020    negative regulation of calcium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of calcium ion transmembrane transporter activity.
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.
    GO:0043242    negative regulation of protein complex disassembly    Any process that stops, prevents, or reduces the frequency, rate or extent of protein complex disassembly, the disaggregation of a protein complex into its constituent components.
    GO:1901881    positive regulation of protein depolymerization    Any process that activates or increases the frequency, rate or extent of protein depolymerization.
    GO:0051924    regulation of calcium ion transport    Any process that modulates the frequency, rate or extent of the directed movement of calcium ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:1901894    regulation of calcium-transporting ATPase activity    Any process that modulates the frequency, rate or extent of calcium-transporting ATPase activity.
    GO:1901077    regulation of relaxation of muscle    Any process that modulates the frequency, rate or extent of relaxation of muscle.
    GO:0070296    sarcoplasmic reticulum calcium ion transport    The directed movement of calcium ions (Ca2+) into, out of or within the sarcoplasmic reticulum.
cellular component
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0016529    sarcoplasmic reticulum    A fine reticular network of membrane-limited elements that pervades the sarcoplasm of a muscle cell; continuous over large portions of the cell and with the nuclear envelope; that part of the endoplasmic reticulum specialized for calcium release, uptake and storage.
    GO:0033017    sarcoplasmic reticulum membrane    The lipid bilayer surrounding the sarcoplasmic reticulum.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1jdm)
 
  Sites
(no "Sites" information available for 1jdm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1jdm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1jdm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SARCO_HUMAN | O00631
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SARCO_HUMAN | O00631
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1JDM)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1JDM)