|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1JD3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1JD3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JD3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1JD3) |
Exons (0, 0)| (no "Exon" information available for 1JD3) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:164 aligned with UBIC_ECOLI | P26602 from UniProtKB/Swiss-Prot Length:165 Alignment length:164 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 UBIC_ECOLI 2 SHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY 165 SCOP domains d1jd3a_ A: Chorismate lyase SCOP domains CATH domains 1jd3A00 A:1-164 Chorismate lyase CATH domains Pfam domains --------Chor_lyase-1jd3A01 A:9-164 Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1jd3 A 1 SHPALTQLRALRYSKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLSADGEPWLAARTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY 164 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (UBIC_ECOLI | P26602)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|