Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE MRP14 COMPLEXED WITH CHAPS
 
Authors :  H. Itou, M. Yao, N. Watanabe, J. Nishihira, I. Tanaka
Date :  09 Oct 01  (Deposition) - 27 Feb 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Keywords :  Calgranulin B, Mrp14, S100A9, Ef-Hand, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Itou, M. Yao, I. Fujita, N. Watanabe, M. Suzuki, J. Nishihira, I. Tanaka
The Crystal Structure Of Human Mrp14 (S100A9), A Ca(2+)-Dependent Regulator Protein In Inflammatory Process.
J. Mol. Biol. V. 316 265 2002
PubMed-ID: 11851337  |  Reference-DOI: 10.1006/JMBI.2001.5340
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MIGRATION INHIBITORY FACTOR-RELATED PROTEIN 14
    ChainsA, B, C, D, E, F, G, H
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET3A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (1x)AB      
Biological Unit 2 (1x)  CD    
Biological Unit 3 (1x)    EF  
Biological Unit 4 (1x)      GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 20)

Asymmetric Unit (2, 20)
No.NameCountTypeFull Name
1CA16Ligand/IonCALCIUM ION
2CPS4Ligand/Ion3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CPS1Ligand/Ion3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CPS2Ligand/Ion3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE
Biological Unit 3 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CPS-1Ligand/Ion3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CPS1Ligand/Ion3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:23 , LEU A:26 , HIS A:28 , THR A:31 , GLU A:36 , HOH A:190BINDING SITE FOR RESIDUE CA A 187
02AC2SOFTWAREASP A:67 , ASN A:69 , ASP A:71 , GLN A:73 , GLU A:78 , HOH A:207BINDING SITE FOR RESIDUE CA A 188
03AC3SOFTWARESER B:23 , LEU B:26 , HIS B:28 , THR B:31 , GLU B:36 , HOH B:192BINDING SITE FOR RESIDUE CA B 187
04AC4SOFTWAREASP B:67 , ASN B:69 , ASP B:71 , GLN B:73 , GLU B:78 , HOH B:204BINDING SITE FOR RESIDUE CA B 188
05AC5SOFTWARESER C:23 , LEU C:26 , HIS C:28 , THR C:31 , GLU C:36 , HOH C:193BINDING SITE FOR RESIDUE CA C 187
06AC6SOFTWAREASP C:67 , ASN C:69 , ASP C:71 , GLN C:73 , GLU C:78 , HOH C:194BINDING SITE FOR RESIDUE CA C 188
07AC7SOFTWARESER D:23 , LEU D:26 , HIS D:28 , THR D:31 , GLU D:36 , HOH D:409BINDING SITE FOR RESIDUE CA D 187
08AC8SOFTWAREASP D:67 , ASN D:69 , ASP D:71 , GLN D:73 , GLU D:78 , HOH D:408BINDING SITE FOR RESIDUE CA D 188
09AC9SOFTWARESER E:23 , LEU E:26 , HIS E:28 , THR E:31 , GLU E:36 , HOH E:193BINDING SITE FOR RESIDUE CA E 187
10BC1SOFTWAREASP E:67 , ASN E:69 , ASP E:71 , GLN E:73 , GLU E:78 , HOH E:197BINDING SITE FOR RESIDUE CA E 188
11BC2SOFTWARESER F:23 , LEU F:26 , HIS F:28 , THR F:31 , GLU F:36BINDING SITE FOR RESIDUE CA F 187
12BC3SOFTWAREASP F:67 , ASN F:69 , ASP F:71 , GLN F:73 , GLU F:78BINDING SITE FOR RESIDUE CA F 188
13BC4SOFTWARESER G:23 , LEU G:26 , HIS G:28 , THR G:31 , GLU G:36 , HOH G:518BINDING SITE FOR RESIDUE CA G 187
14BC5SOFTWAREASP G:67 , ASN G:69 , ASP G:71 , GLN G:73 , GLU G:78 , HOH G:519BINDING SITE FOR RESIDUE CA G 188
15BC6SOFTWARESER H:23 , LEU H:26 , HIS H:28 , THR H:31 , GLU H:36 , HOH H:214BINDING SITE FOR RESIDUE CA H 187
16BC7SOFTWAREASP H:67 , ASN H:69 , ASP H:71 , GLN H:73 , GLU H:78 , HOH H:213BINDING SITE FOR RESIDUE CA H 188
17BC8SOFTWAREPHE B:48 , GLU B:52 , ASP B:65 , LEU B:86BINDING SITE FOR RESIDUE CPS B 189
18BC9SOFTWAREPHE D:48 , GLU D:52 , HIS D:61 , ASP D:65 , ARG D:85 , LEU D:86 , VAL E:58BINDING SITE FOR RESIDUE CPS D 289
19CC1SOFTWARELYS D:51 , GLU D:52 , PHE E:48 , GLU E:52 , VAL E:58 , HIS E:61 , ASP E:65BINDING SITE FOR RESIDUE CPS D 389
20CC2SOFTWARELYS B:51 , GLU B:52 , PHE G:48 , GLU G:52 , VAL G:58 , HIS G:61 , ASP G:65 , LEU G:86BINDING SITE FOR RESIDUE CPS G 489

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1IRJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1IRJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 8)

Asymmetric Unit (1, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_013008H20RS10A9_HUMANPolymorphism  ---A/B/C/D/E/F/G/HH20R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_013008H20RS10A9_HUMANPolymorphism  ---A/BH20R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_013008H20RS10A9_HUMANPolymorphism  ---C/DH20R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_013008H20RS10A9_HUMANPolymorphism  ---E/FH20R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_013008H20RS10A9_HUMANPolymorphism  ---G/HH20R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 24)

Asymmetric Unit (3, 24)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S10A9_HUMAN54-89
 
 
 
 
 
 
 
  8A:54-86
B:54-86
C:54-86
D:54-86
E:54-86
F:54-86
G:54-86
H:54-86
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10A9_HUMAN62-83
 
 
 
 
 
 
 
  8A:62-83
B:62-83
C:62-83
D:62-83
E:62-83
F:62-83
G:62-83
H:62-83
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S10A9_HUMAN67-79
 
 
 
 
 
 
 
  8A:67-79
B:67-79
C:67-79
D:67-79
E:67-79
F:67-79
G:67-79
H:67-79
Biological Unit 1 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S10A9_HUMAN54-89
 
 
 
 
 
 
 
  2A:54-86
B:54-86
-
-
-
-
-
-
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10A9_HUMAN62-83
 
 
 
 
 
 
 
  2A:62-83
B:62-83
-
-
-
-
-
-
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S10A9_HUMAN67-79
 
 
 
 
 
 
 
  2A:67-79
B:67-79
-
-
-
-
-
-
Biological Unit 2 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S10A9_HUMAN54-89
 
 
 
 
 
 
 
  2-
-
C:54-86
D:54-86
-
-
-
-
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10A9_HUMAN62-83
 
 
 
 
 
 
 
  2-
-
C:62-83
D:62-83
-
-
-
-
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S10A9_HUMAN67-79
 
 
 
 
 
 
 
  2-
-
C:67-79
D:67-79
-
-
-
-
Biological Unit 3 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S10A9_HUMAN54-89
 
 
 
 
 
 
 
  2-
-
-
-
E:54-86
F:54-86
-
-
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10A9_HUMAN62-83
 
 
 
 
 
 
 
  2-
-
-
-
E:62-83
F:62-83
-
-
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S10A9_HUMAN67-79
 
 
 
 
 
 
 
  2-
-
-
-
E:67-79
F:67-79
-
-
Biological Unit 4 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S10A9_HUMAN54-89
 
 
 
 
 
 
 
  2-
-
-
-
-
-
G:54-86
H:54-86
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10A9_HUMAN62-83
 
 
 
 
 
 
 
  2-
-
-
-
-
-
G:62-83
H:62-83
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S10A9_HUMAN67-79
 
 
 
 
 
 
 
  2-
-
-
-
-
-
G:67-79
H:67-79

(-) Exons   (2, 16)

Asymmetric Unit (2, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003687381ENSE00001072566chr1:153330330-15333035728S10A9_HUMAN-00--
1.2ENST000003687382ENSE00001447878chr1:153330745-153330909165S10A9_HUMAN1-50508A:2-50
B:3-50
C:4-50
D:5-50
E:4-50
F:3-50
G:3-50
H:2-50
49
48
47
46
47
48
48
49
1.3ENST000003687383ENSE00001512631chr1:153333120-153333503384S10A9_HUMAN51-114648A:51-86
B:51-86
C:51-86
D:51-86
E:51-86
F:51-86
G:51-86
H:51-86
36
36
36
36
36
36
36
36

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:85
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:85
                                    11        21        31        41        51        61        71        81     
           S10A9_HUMAN    2 TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irja_ A: Calcyclin (S100)                                                           SCOP domains
               CATH domains 1irjA00 A:2-86 EF-hand                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----------------------------------------------------EF_HAND_2  PDB: A:54-86           PROSITE (1)
                PROSITE (2) ------------------------------------------------------------S100_CABP  PDB: A:62-8--- PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: A:2-50 UniProt: 1-50 [INCOMPLETE] Exon 1.3  PDB: A:51-86 [INCOMPLETE]  Transcript 1
                  1irj A  2 TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    11        21        31        41        51        61        71        81     

Chain B from PDB  Type:PROTEIN  Length:84
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:84
                                    12        22        32        42        52        62        72        82    
           S10A9_HUMAN    3 CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irjb_ B: Calcyclin (S100)                                                          SCOP domains
               CATH domains 1irjB00 B:3-86 EF-hand                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------------------------------------------EF_HAND_2  PDB: B:54-86           PROSITE (1)
                PROSITE (2) -----------------------------------------------------------S100_CABP  PDB: B:62-8--- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: B:3-50 UniProt: 1-50 [INCOMPLETE]Exon 1.3  PDB: B:51-86 [INCOMPLETE]  Transcript 1
                  1irj B  3 CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    12        22        32        42        52        62        72        82    

Chain C from PDB  Type:PROTEIN  Length:83
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:83
                                    13        23        33        43        53        63        73        83   
           S10A9_HUMAN    4 KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irjc_ C: Calcyclin (S100)                                                         SCOP domains
               CATH domains 1irjC00 C:4-86 EF-hand                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --------------------------------------------------EF_HAND_2  PDB: C:54-86           PROSITE (1)
                PROSITE (2) ----------------------------------------------------------S100_CABP  PDB: C:62-8--- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: C:4-50 UniProt: 1-50            Exon 1.3  PDB: C:51-86 [INCOMPLETE]  Transcript 1
                  1irj C  4 KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    13        23        33        43        53        63        73        83   

Chain D from PDB  Type:PROTEIN  Length:82
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:82
                                    14        24        34        44        54        64        74        84  
           S10A9_HUMAN    5 MSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irjd_ D: Calcyclin (S100)                                                        SCOP domains
               CATH domains 1irjD00 D:5-86 EF-hand                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -------------------------------------------------EF_HAND_2  PDB: D:54-86           PROSITE (1)
                PROSITE (2) ---------------------------------------------------------S100_CABP  PDB: D:62-8--- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: D:5-50 UniProt: 1-50           Exon 1.3  PDB: D:51-86 [INCOMPLETE]  Transcript 1
                  1irj D  5 MSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    14        24        34        44        54        64        74        84  

Chain E from PDB  Type:PROTEIN  Length:83
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:83
                                    13        23        33        43        53        63        73        83   
           S10A9_HUMAN    4 KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irje_ E: Calcyclin (S100)                                                         SCOP domains
               CATH domains 1irjE00 E:4-86 EF-hand                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --------------------------------------------------EF_HAND_2  PDB: E:54-86           PROSITE (1)
                PROSITE (2) ----------------------------------------------------------S100_CABP  PDB: E:62-8--- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: E:4-50 UniProt: 1-50            Exon 1.3  PDB: E:51-86 [INCOMPLETE]  Transcript 1
                  1irj E  4 KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    13        23        33        43        53        63        73        83   

Chain F from PDB  Type:PROTEIN  Length:84
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:84
                                    12        22        32        42        52        62        72        82    
           S10A9_HUMAN    3 CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irjf_ F: Calcyclin (S100)                                                          SCOP domains
               CATH domains 1irjF00 F:3-86 EF-hand                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh..............hhhhhhhhhhhh....hhhhh.hhhhhhhhhhhhh.......hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -----------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------------------------------------------EF_HAND_2  PDB: F:54-86           PROSITE (1)
                PROSITE (2) -----------------------------------------------------------S100_CABP  PDB: F:62-8--- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: F:3-50 UniProt: 1-50 [INCOMPLETE]Exon 1.3  PDB: F:51-86 [INCOMPLETE]  Transcript 1
                  1irj F  3 CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    12        22        32        42        52        62        72        82    

Chain G from PDB  Type:PROTEIN  Length:84
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:84
                                    12        22        32        42        52        62        72        82    
           S10A9_HUMAN    3 CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irjg_ G: Calcyclin (S100)                                                          SCOP domains
               CATH domains 1irjG00 G:3-86 EF-hand                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------------------------------------------EF_HAND_2  PDB: G:54-86           PROSITE (1)
                PROSITE (2) -----------------------------------------------------------S100_CABP  PDB: G:62-8--- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: G:3-50 UniProt: 1-50 [INCOMPLETE]Exon 1.3  PDB: G:51-86 [INCOMPLETE]  Transcript 1
                  1irj G  3 CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    12        22        32        42        52        62        72        82    

Chain H from PDB  Type:PROTEIN  Length:85
 aligned with S10A9_HUMAN | P06702 from UniProtKB/Swiss-Prot  Length:114

    Alignment length:85
                                    11        21        31        41        51        61        71        81     
           S10A9_HUMAN    2 TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
               SCOP domains d1irjh_ H: Calcyclin (S100)                                                           SCOP domains
               CATH domains 1irjH00 H:2-86 EF-hand                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------R------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----------------------------------------------------EF_HAND_2  PDB: H:54-86           PROSITE (1)
                PROSITE (2) ------------------------------------------------------------S100_CABP  PDB: H:62-8--- PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------EF_HAND_1    ------- PROSITE (3)
               Transcript 1 Exon 1.2  PDB: H:2-50 UniProt: 1-50 [INCOMPLETE] Exon 1.3  PDB: H:51-86 [INCOMPLETE]  Transcript 1
                  1irj H  2 TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL 86
                                    11        21        31        41        51        61        71        81     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 8)

Asymmetric Unit

(-) CATH Domains  (1, 8)

Asymmetric Unit
1a1irjA00A:2-86
1b1irjH00H:2-86
1c1irjB00B:3-86
1d1irjF00F:3-86
1e1irjG00G:3-86
1f1irjC00C:4-86
1g1irjE00E:4-86
1h1irjD00D:5-86

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IRJ)

(-) Gene Ontology  (52, 52)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H   (S10A9_HUMAN | P06702)
molecular function
    GO:0050786    RAGE receptor binding    Interacting selectively and non-covalently with the RAGE receptor, the receptor for advanced glycation end-products.
    GO:0035662    Toll-like receptor 4 binding    Interacting selectively and non-covalently with a Toll-like 4 protein, a pattern recognition receptor that binds bacterial lipopolysaccharide (LPS) to initiate an innate immune response.
    GO:0016209    antioxidant activity    Inhibition of the reactions brought about by dioxygen (O2) or peroxides. Usually the antioxidant is effective because it can itself be more easily oxidized than the substance protected. The term is often applied to components that can trap free radicals, thereby breaking the chain reaction that normally leads to extensive biological damage.
    GO:0050544    arachidonic acid binding    Interacting selectively and non-covalently with arachidonic acid, a straight chain fatty acid with 20 carbon atoms and four double bonds per molecule. Arachidonic acid is the all-Z-(5,8,11,14)-isomer.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0031532    actin cytoskeleton reorganization    A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of constituent parts of cytoskeletal structures comprising actin filaments and their associated proteins.
    GO:0006919    activation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0014002    astrocyte development    The process aimed at the progression of an astrocyte over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell. An astrocyte is the most abundant type of glial cell. Astrocytes provide support for neurons and regulate the environment in which they function.
    GO:0006914    autophagy    The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0032602    chemokine production    The appearance of a chemokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
    GO:0006935    chemotaxis    The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
    GO:0001816    cytokine production    The appearance of a cytokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0030595    leukocyte chemotaxis    The movement of a leukocyte in response to an external stimulus.
    GO:0002523    leukocyte migration involved in inflammatory response    The movement of a leukocyte within or between different tissues and organs of the body contributing to an inflammatory response.
    GO:0070488    neutrophil aggregation    The adhesion of one neutrophil to one or more other neutrophils via adhesion molecules.
    GO:0030593    neutrophil chemotaxis    The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
    GO:0018119    peptidyl-cysteine S-nitrosylation    The covalent addition of a nitric oxide (NO) group to the sulphur (S) atom of a cysteine residue in a protein, to form peptidyl-S-nitrosyl-L-cysteine.
    GO:0035606    peptidyl-cysteine S-trans-nitrosylation    Transfer of a nitric oxide (NO) group from one cysteine residue to another.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0030194    positive regulation of blood coagulation    Any process that activates or increases the frequency, rate or extent of blood coagulation.
    GO:0030307    positive regulation of cell growth    Any process that activates or increases the frequency, rate, extent or direction of cell growth.
    GO:0050729    positive regulation of inflammatory response    Any process that activates or increases the frequency, rate or extent of the inflammatory response.
    GO:2001244    positive regulation of intrinsic apoptotic signaling pathway    Any process that activates or increases the frequency, rate or extent of intrinsic apoptotic signaling pathway.
    GO:0002793    positive regulation of peptide secretion    Any process that activates or increases the frequency, rate, or extent of peptide secretion.
    GO:0051493    regulation of cytoskeleton organization    Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures.
    GO:0050727    regulation of inflammatory response    Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
    GO:0045113    regulation of integrin biosynthetic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of integrins.
    GO:0006417    regulation of translation    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0032119    sequestering of zinc ion    The process of binding or confining zinc ions such that they are separated from other components of a biological system.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CPS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1irj)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1irj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S10A9_HUMAN | P06702
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  S10A9_HUMAN | P06702
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        S10A9_HUMAN | P067021xk4 4ggf 4xjk 5i8n 5w1f

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1IRJ)