1HY3 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN ESTROGEN SULFOTRANSFERASE V269E MUTANT IN THE PRESENCE OF PAPS

Authors :   L. C. Pedersen, E. V. Petrochenko, S. Shevtsov, M. Negishi

Date :   17 Jan 01 (Deposition) - 19 Jun 02 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A,B

Keywords :   Estrogen, Sulfotransferase, Paps, Human (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. C. Pedersen, E. Petrotchenko, S. Shevtsov, M. Negishi
Crystal Structure Of The Human Estrogen Sulfotransferase-Paps Complex: Evidence For Catalytic Role Of Ser137 In The Sulfuryl Transfer Reaction.
J. Biol. Chem. V. 277 17928 2002
PubMed-ID: 11884392 | Reference-DOI: 10.1074/JBC.M111651200
(for further references see the PDB file header)

Molecule 1 - ESTROGEN SULFOTRANSFERASE
	Chains	:	A, B
	EC Number	:	2.8.2.4
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX4T3
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	STE
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SULFOTRANSFERASE, ESTROGEN-PREFERRING

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	PPS	2	Ligand/Ion	3'-PHOSPHATE-ADENOSINE-5'-PHOSPHATE SULFATE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PRO B:46 , LYS B:47 , SER B:48 , GLY B:49 , THR B:50 , THR B:51 , TRP B:52 , LYS B:105 , HIS B:107 , ARG B:129 , SER B:137 , TYR B:192 , THR B:226 , PHE B:228 , MET B:231 , PHE B:254 , MET B:255 , ARG B:256 , LYS B:257 , GLY B:258 , HOH B:508 , HOH B:512 , HOH B:517 , HOH B:536 , HOH B:580 , HOH B:604 , HOH B:674	BINDING SITE FOR RESIDUE PPS B 502
2	AC2	SOFTWARE	LYS A:47 , SER A:48 , GLY A:49 , THR A:50 , THR A:51 , TRP A:52 , LYS A:105 , HIS A:107 , ARG A:129 , SER A:137 , PHE A:141 , TYR A:192 , THR A:226 , PHE A:228 , MET A:231 , PHE A:254 , MET A:255 , ARG A:256 , LYS A:257 , GLY A:258 , HOH A:608 , HOH A:611 , HOH A:617 , HOH A:620 , HOH A:634 , HOH A:644 , HOH A:740	BINDING SITE FOR RESIDUE PPS A 602

(no "SS Bond" information available for 1HY3)

Asymmetric/Biological Unit

No.	Residues
1	Ser A:100	-	Pro A:101
2	Ser B:100	-	Pro B:101

Asymmetric/Biological Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018907	D	22	Y	ST1E1_HUMAN	Polymorphism	11569705	A/B	D	22	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1HY3)

Asymmetric/Biological Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000226444	1a	ENSE00001024505	chr4:70725870-70725767	104	ST1E1_HUMAN	-	0	0	-	-
1.2	ENST00000226444	2	ENSE00002201157	chr4:70723371-70723218	154	ST1E1_HUMAN	1-49	49	2	A:2-49 B:3-49	48 47
1.3	ENST00000226444	3	ENSE00000720189	chr4:70721144-70721019	126	ST1E1_HUMAN	49-91	43	2	A:49-91 B:49-91	43 43
1.4	ENST00000226444	4	ENSE00000720186	chr4:70720032-70719935	98	ST1E1_HUMAN	91-123	33	2	A:91-123 B:91-123	33 33
1.5a	ENST00000226444	5a	ENSE00000720182	chr4:70715281-70715155	127	ST1E1_HUMAN	124-166	43	2	A:124-166 B:124-166	43 43
1.6a	ENST00000226444	6a	ENSE00000720178	chr4:70713510-70713416	95	ST1E1_HUMAN	166-197	32	2	A:166-197 B:166-197	32 32
1.7	ENST00000226444	7	ENSE00000720173	chr4:70710059-70709879	181	ST1E1_HUMAN	198-258	61	2	A:198-258 (gaps) B:198-258	61 61
1.8b	ENST00000226444	8b	ENSE00001180361	chr4:70707824-70706930	895	ST1E1_HUMAN	258-294	37	2	A:258-290 B:258-290	33 33

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:287
 aligned with ST1E1_HUMAN | P49888 from UniProtKB/Swiss-Prot  Length:294

    Alignment length:289
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281         
          ST1E1_HUMAN     2 NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKF 290
               SCOP domains d1hy3a_ A: Estrogen sulfotransferase (STE, sult1e1)                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1hy3A00 A:2-290 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeee..eeeehhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhh..........hhhhhh.....ee...ee............eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh................--........hhhhhh.hhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------Y---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:2-49 UniProt: 1-49 [INCOMPLETE]-----------------------------------------Exon 1.4  PDB: A:91-123          Exon 1.5a  PDB: A:124-166 UniProt: 124-166 -------------------------------Exon 1.7  PDB: A:198-258 (gaps) UniProt: 198-258             -------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.3  PDB: A:49-91 UniProt: 49-91      --------------------------------------------------------------------------Exon 1.6a  PDB: A:166-197       ------------------------------------------------------------Exon 1.8b  PDB: A:258-290         Transcript 1 (2)
                 1hy3 A   2 NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQK--PFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF 290
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241        |- |     261       271       281         
                                                                                                                                                                                                                                                                                  250  |                                     
                                                                                                                                                                                                                                                                                     253

Chain B from PDB  Type:PROTEIN  Length:288
 aligned with ST1E1_HUMAN | P49888 from UniProtKB/Swiss-Prot  Length:294

    Alignment length:288
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282        
          ST1E1_HUMAN     3 SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKF 290
               SCOP domains d1hy3b_ B: Estrogen sulfotransferase (STE, sult1e1)                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1hy3B00 B:3-290 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhheeee..eeeehhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhh..........hhhhhh.....ee...eehhhhhhh.....eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..........................hhhhhh.hhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------Y---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:3-49 UniProt: 1-49            -----------------------------------------Exon 1.4  PDB: B:91-123          Exon 1.5a  PDB: B:124-166 UniProt: 124-166 -------------------------------Exon 1.7  PDB: B:198-258 UniProt: 198-258                    -------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.3  PDB: B:49-91 UniProt: 49-91      --------------------------------------------------------------------------Exon 1.6a  PDB: B:166-197       ------------------------------------------------------------Exon 1.8b  PDB: B:258-290         Transcript 1 (2)
                 1hy3 B   3 SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF 290
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: PAPS sulfotransferase (54)

Protein domain: Estrogen sulfotransferase (STE, sult1e1) (8)

Human (Homo sapiens) [TaxId: 9606] (5)

1a	d1hy3a_	A:
1b	d1hy3b_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1a	1hy3A00	A:2-290
1b	1hy3B00	B:3-290

(no "Pfam Domain" information available for 1HY3)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (ST1E1_HUMAN | P49888)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0004304	estrone sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate.
	GO:0047894	flavonol 3-sulfotransferase activity	Catalysis of the reaction: 3'-phospho-5'-adenylyl sulfate + quercetin = adenosine 3',5'-diphosphate + H(+) + quercetin 3-sulfate.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005496	steroid binding	Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
	GO:0050294	steroid sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenolic steroid = adenosine 3',5'-bisphosphate + steroid O-sulfate.
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0008210	estrogen metabolic process	The chemical reactions and pathways involving estrogens, C18 steroid hormones that can stimulate the development of female sexual characteristics. Also found in plants.
	GO:0045600	positive regulation of fat cell differentiation	Any process that activates or increases the frequency, rate or extent of adipocyte differentiation.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PPS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser A:100 - Pro A:101	[ RasMol ]
		Ser B:100 - Pro B:101	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1hy3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1E1_HUMAN \| P49888
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.4
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ST1E1_HUMAN \| P49888
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ST1E1_HUMAN \| P49888	:	1g3m 4jvl 4jvm 4jvn

1g3m	CRYSTAL STRUCTURE OF HUMAN ESTROGEN SULFOTRANSFERASE IN COMPLEX WITH IN-ACTIVE COFACTOR PAP AND 3,5,3',5'- TETRACHLORO-BIPHENYL-4,4'-DIOL

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File