Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  MIDDLE DOMAIN OF HUMAN EIF4GII
 
Authors :  J. Marcotrigiano, I. Lomakin, T. V. Pestova, C. U. T. Hellen, N. Sonenberg, S. K. Burley
Date :  03 Jan 01  (Deposition) - 21 Feb 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.37
Chains :  Asym./Biol. Unit :  A
Keywords :  Eif4G, Heat Repeat, Translation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Marcotrigiano, I. B. Lomakin, N. Sonenberg, T. V. Pestova, C. U. Hellen, S. K. Burley
A Conserved Heat Domain Within Eif4G Directs Assembly Of The Translation Initiation Machinery.
Mol. Cell V. 7 193 2001
PubMed-ID: 11172724  |  Reference-DOI: 10.1016/S1097-2765(01)00167-8
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EIF4GII
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PLASMID
    Fragment: RESIDUES 745-1003
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: EUKARYOTIC INITIATION FACTOR 4GII

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric/Biological Unit (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1HU3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1HU3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1HU3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1HU3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1HU3)

(-) Exons   (6, 6)

Asymmetric/Biological Unit (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.9ENST000002642119ENSE00001662049chr1:21377487-21377359129IF4G3_HUMAN-00--
1.10ENST0000026421110ENSE00001633834chr1:21329301-2132920696IF4G3_HUMAN1-10100--
1.15bENST0000026421115bENSE00001315125chr1:21307720-21307541180IF4G3_HUMAN11-70600--
1.16ENST0000026421116ENSE00001066157chr1:21306941-21306827115IF4G3_HUMAN71-109390--
1.17bENST0000026421117bENSE00001066154chr1:21299592-2129949598IF4G3_HUMAN109-141330--
1.18ENST0000026421118ENSE00002201727chr1:21296089-21295967123IF4G3_HUMAN142-182410--
1.19bENST0000026421119bENSE00001686750chr1:21276604-21276496109IF4G3_HUMAN183-219370--
1.20ENST0000026421120ENSE00001724487chr1:21268823-21267984840IF4G3_HUMAN219-4992810--
1.23aENST0000026421123aENSE00001796290chr1:21231464-2123137689IF4G3_HUMAN499-528300--
1.24ENST0000026421124ENSE00001670057chr1:21226436-21226190247IF4G3_HUMAN529-611830--
1.25ENST0000026421125ENSE00001714353chr1:21221994-21221861134IF4G3_HUMAN611-655450--
1.26aENST0000026421126aENSE00001727110chr1:21220129-21220010120IF4G3_HUMAN656-695400--
1.28ENST0000026421128ENSE00001690105chr1:21212864-21212694171IF4G3_HUMAN696-752571A:1-7529
1.29ENST0000026421129ENSE00001594127chr1:21206013-21205816198IF4G3_HUMAN753-818661A:753-81866
1.30ENST0000026421130ENSE00001658251chr1:21191755-21191609147IF4G3_HUMAN819-867491A:819-850 (gaps)32
1.31ENST0000026421131ENSE00001703965chr1:21191205-21190969237IF4G3_HUMAN868-946791A:881-94666
1.32ENST0000026421132ENSE00001604127chr1:21188825-21188721105IF4G3_HUMAN947-981351A:947-98135
1.33ENST0000026421133ENSE00001764077chr1:21187010-21186878133IF4G3_HUMAN982-1026451A:982-9865
1.34ENST0000026421134ENSE00001804546chr1:21183990-2118389695IF4G3_HUMAN1026-1057320--
1.35ENST0000026421135ENSE00001712596chr1:21181564-2118147194IF4G3_HUMAN1058-1089320--
1.36ENST0000026421136ENSE00001726513chr1:21180170-21180053118IF4G3_HUMAN1089-1128400--
1.37ENST0000026421137ENSE00001784396chr1:21177971-21177751221IF4G3_HUMAN1128-1202750--
1.38ENST0000026421138ENSE00001690531chr1:21176023-21175908116IF4G3_HUMAN1202-1240390--
1.40ENST0000026421140ENSE00001657209chr1:21167521-21167349173IF4G3_HUMAN1241-1298580--
1.41ENST0000026421141ENSE00001697967chr1:21155765-21155640126IF4G3_HUMAN1298-1340430--
1.42ENST0000026421142ENSE00001643208chr1:21154191-2115411082IF4G3_HUMAN1340-1367280--
1.43bENST0000026421143bENSE00002176939chr1:21151691-2115159399IF4G3_HUMAN1368-1400330--
1.44ENST0000026421144ENSE00001672406chr1:21144031-21143885147IF4G3_HUMAN1401-1449490--
1.45ENST0000026421145ENSE00001604595chr1:21139732-2113965182IF4G3_HUMAN1450-1477280--
1.46ENST0000026421146ENSE00001683487chr1:21137377-21137231147IF4G3_HUMAN1477-1526500--
1.47bENST0000026421147bENSE00001542805chr1:21133993-211329721022IF4G3_HUMAN1526-1585600--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:204
 aligned with IF4G3_HUMAN | O43432 from UniProtKB/Swiss-Prot  Length:1585

    Alignment length:243
                                   753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983   
          IF4G3_HUMAN   744 DDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVS 986
               SCOP domains d1hu3a_ A: Eukaryotic initiation factor eIF4G                                                                                                                                                                                                       SCOP domains
               CATH domains 1hu3A00 A:1-986  [code=1.25.40.180, no name defined]                                                                                                                                                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh.....---------hhhhhhhhhhhhhhhhhh.------------------------------...hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.28Exon 1.29  PDB: A:753-818 UniProt: 753-818                        Exon 1.30  PDB: A:819-850 (gaps) UniProt: 819-867Exon 1.31  PDB: A:881-946 UniProt: 868-946 [INCOMPLETE]                        Exon 1.32  PDB: A:947-981          1.33  Transcript 1
                 1hu3 A   1 SDPENIKTQELFRKVRSILNKLTPQmFNQLmKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANmCRCLVTLKVP---------NFRKLLLNRCQKEFEKDKA------------------------------AKDKARRRSIGNIKFIGELFKLKmLTEAImHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRmDQYFNQmEKIVKERKTSSRIRFmLQDVIDLRLCNWVS 986
                            ||     753       763     | 773|      783       793       803       813        |-       833       843      |  -         -         -       883       893       903|     |913       923       933       943     | 953  |    963       973       983   
                            ||                     769-MSE|                                   812-MSE   822       832               850                            881                    904-MSE |                                    949-MSE  |             972-MSE          
                            1|                          774-MSE                                                                                                                                 910-MSE                                       956-MSE                          
                           745
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HU3)

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (IF4G3_HUMAN | O43432)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0000339    RNA cap binding    Interacting selectively and non-covalently with a 7-methylguanosine (m7G) group or derivative located at the 5' end of an RNA molecule.
    GO:0008135    translation factor activity, RNA binding    Functions during translation by interacting selectively and non-covalently with RNA during polypeptide synthesis at the ribosome.
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0006417    regulation of translation    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016281    eukaryotic translation initiation factor 4F complex    The eukaryotic translation initiation factor 4F complex is composed of eIF4E, eIF4A and eIF4G; it is involved in the recognition of the mRNA cap, ATP-dependent unwinding of the 5'-terminal secondary structure and recruitment of the mRNA to the ribosome.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1hu3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1hu3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1hu3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IF4G3_HUMAN | O43432
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IF4G3_HUMAN | O43432
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1HU3)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1HU3)