Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN TETRANECTIN, A TRIMERIC PLASMINOGEN BINDING PROTEIN WITH AN ALPHA-HELICAL COILED COIL
 
Authors :  B. B. Nielsen, J. S. Kastrup, H. Rasmussen, T. L. Holtet, J. H. Graversen, M. Etzerodt, H. C. Thogersen, I. K. Larsen
Date :  28 May 97  (Deposition) - 03 Dec 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Tetranectin, Plasminogen Binding, Kringle 4, Alpha-Helical Coiled Coil, C-Type Lectin, Carbohydrate Recognition Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. B. Nielsen, J. S. Kastrup, H. Rasmussen, T. L. Holtet, J. H. Graversen, M. Etzerodt, H. C. Thogersen, I. K. Larsen
Crystal Structure Of Tetranectin, A Trimeric Plasminogen-Binding Protein With An Alpha-Helical Coiled Coil.
Febs Lett. V. 412 388 1997
PubMed-ID: 9256258  |  Reference-DOI: 10.1016/S0014-5793(97)00664-9
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TETRANECTIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPT7H6
    Expression System StrainDH
    Expression System Taxid562
    FragmentRESIDUES 26 - 181
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (3x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:116 , GLU A:120 , GLY A:147 , GLU A:150 , ASN A:151 , HOH A:188BINDING SITE FOR RESIDUE CA A 182
2AC2SOFTWAREGLN A:143 , ASP A:145 , GLU A:150 , ASP A:165BINDING SITE FOR RESIDUE CA A 183
3CA1UNKNOWNASP A:116 , GLU A:120 , GLY A:147 , GLU A:150 , ASN A:151 , CA A:183 , HOH A:188CALCIUM BINDING SITE 1.
4CA2UNKNOWNGLN A:143 , ASP A:145 , GLU A:150 , ASP A:165 , CA A:182CALCIUM BINDING SITE 2.

(-) SS Bonds  (3, 3)

Asymmetric Unit
No.Residues
1A:50 -A:60
2A:77 -A:176
3A:152 -A:168

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gln A:143 -Pro A:144

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_004189A55STETN_HUMANPolymorphism  ---AS34S
2UniProtVAR_004190V58MTETN_HUMANPolymorphism  ---AV37M
3UniProtVAR_012318G106STETN_HUMANPolymorphism13963AS85S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 9)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_004189A55STETN_HUMANPolymorphism  ---AS34S
2UniProtVAR_004190V58MTETN_HUMANPolymorphism  ---AV37M
3UniProtVAR_012318G106STETN_HUMANPolymorphism13963AS85S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1C_TYPE_LECTIN_2PS50041 C-type lectin domain profile.TETN_HUMAN77-198  1A:56-177
2C_TYPE_LECTIN_1PS00615 C-type lectin domain signature.TETN_HUMAN173-197  1A:152-176
Biological Unit 1 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1C_TYPE_LECTIN_2PS50041 C-type lectin domain profile.TETN_HUMAN77-198  3A:56-177
2C_TYPE_LECTIN_1PS00615 C-type lectin domain signature.TETN_HUMAN173-197  3A:152-176

(-) Exons   (2, 2)

Asymmetric Unit (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2ENST000002961302ENSE00001281126chr3:45067675-45067963289TETN_HUMAN1-37370--
1.4ENST000002961304ENSE00001776827chr3:45072319-4507241799TETN_HUMAN37-70341A:26-4924
1.5bENST000002961305bENSE00001927042chr3:45077016-45077563548TETN_HUMAN70-2021331A:49-181133

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:156
 aligned with TETN_HUMAN | P05452 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:156
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196      
           TETN_HUMAN    47 LKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV 202
               SCOP domains d1htna2 A:26-53 Tetranectin d1htna1 A:54-181 Tetranectin                                                                                                     SCOP domains
               CATH domains 1htnA00 A:26-181 Mannose-Binding Protein A, subunit A                                                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhheeee..eeeeeee...hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..eeeee.......................................eeeeee....eeeee......eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------S--M-----------------------------------------------S------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------------------------------C_TYPE_LECTIN_2  PDB: A:56-177 UniProt: 77-198                                                                            ---- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ----- PROSITE (2)
           Transcript 1 (1) Exon 1.4  PDB: A:26-49  ------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.5b  PDB: A:49-181 UniProt: 70-202                                                                                              Transcript 1 (2)
                 1htn A  26 LKSRLDTLSQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV 181
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HTN)

(-) Gene Ontology  (17, 17)

Asymmetric Unit(hide GO term definitions)
Chain A   (TETN_HUMAN | P05452)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0036143    kringle domain binding    Interacting selectively and non-covalently with a kringle domain. Kringle domains are protein domains that fold into large loops stabilized by 3 disulfide linkages, and are important in protein-protein interactions with blood coagulation factors.
biological process
    GO:0030282    bone mineralization    The deposition of hydroxyapatite, a form of calcium phosphate with the formula Ca10(PO4)6(OH)2, in bone tissue.
    GO:0071310    cellular response to organic substance    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
    GO:0071560    cellular response to transforming growth factor beta stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
    GO:0001503    ossification    The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0010756    positive regulation of plasminogen activation    Any process that increases the rate, frequency or extent of plasminogen activation. Plasminogen activation is the process in which plasminogen is processed to plasmin.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0001652    granular component    A structure found in the nucleolus, which contains nearly completed preribosomal particles destined for the cytoplasm.
    GO:0031089    platelet dense granule lumen    The volume enclosed by the membrane of the platelet dense granule.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    CA1  [ RasMol ]  +environment [ RasMol ]
    CA2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:143 - Pro A:144   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1htn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TETN_HUMAN | P05452
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TETN_HUMAN | P05452
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TETN_HUMAN | P054521rjh 1tn3 3l9j

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1HTN)