![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1HST) |
(no "Site" information available for 1HST) |
(no "SS Bond" information available for 1HST) |
(no "Cis Peptide Bond" information available for 1HST) |
(no "SAP(SNP)/Variant" information available for 1HST) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1HST) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:74 aligned with H5_CHICK | P02259 from UniProtKB/Swiss-Prot Length:190 Alignment length:74 34 44 54 64 74 84 94 H5_CHICK 25 SHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK 98 SCOP domains d1hsta_ A: Histone H5, globular domain SCOP domains CATH domains 1hstA00 A:24-97 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE H15 PDB: A:24-97 UniProt: 25-98 PROSITE Transcript -------------------------------------------------------------------------- Transcript 1hst A 24 SHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK 97 33 43 53 63 73 83 93 Chain B from PDB Type:PROTEIN Length:74 aligned with H5_CHICK | P02259 from UniProtKB/Swiss-Prot Length:190 Alignment length:74 34 44 54 64 74 84 94 H5_CHICK 25 SHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK 98 SCOP domains d1hstb_ B: Histone H5, globular domain SCOP domains CATH domains 1hstB00 B:24-97 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE H15 PDB: B:24-97 UniProt: 25-98 PROSITE Transcript -------------------------------------------------------------------------- Transcript 1hst B 24 SHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK 97 33 43 53 63 73 83 93
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1HST) |
Asymmetric Unit(hide GO term definitions) Chain A,B (H5_CHICK | P02259)
|
|
|
|
|
|
|