Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HEVEIN: THE NMR ASSIGNMENT AND AN ASSESSMENT OF SOLUTION-STATE FOLDING FOR THE AGGLUTININ-TOXIN MOTIF
 
Authors :  N. H. Andersen, B. Cao
Date :  14 Jan 93  (Deposition) - 31 Jan 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (6x)
Keywords :  Lectin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. H. Andersen, B. Cao, A. Rodriguez-Romero, B. Arreguin
Hevein: Nmr Assignment And Assessment Of Solution-State Folding For The Agglutinin-Toxin Motif.
Biochemistry V. 32 1407 1993
PubMed-ID: 8431421  |  Reference-DOI: 10.1021/BI00057A004
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HEVEIN
    ChainsA
    EngineeredYES
    Organism ScientificHEVEA BRASILIENSIS
    Organism Taxid3981

 Structural Features

(-) Chains, Units

  
NMR Structure (6x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1HEV)

(-) Sites  (0, 0)

(no "Site" information available for 1HEV)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:3 -A:18
2A:12 -A:24
3A:17 -A:31
4A:37 -A:41

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1HEV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_HEVE_HEVBR_001 *N31DHEVE_HEVBR  ---  ---AN14D
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CHIT_BIND_I_1PS00026 Chitin recognition or binding domain signature.HEVE_HEVBR29-48  1A:12-31

(-) Exons   (0, 0)

(no "Exon" information available for 1HEV)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:43
 aligned with HEVE_HEVBR | P02877 from UniProtKB/Swiss-Prot  Length:204

    Alignment length:43
                                    27        37        47        57   
            HEVE_HEVBR   18 EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD 60
               SCOP domains d1heva_ A: Hevein                           SCOP domains
               CATH domains 1hevA00 A:1-43                              CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author ...............eeee...eeee.hhhh.hhh..eee... Sec.struct. author
                 SAPs(SNPs) -------------D----------------------------- SAPs(SNPs)
                    PROSITE -----------CHIT_BIND_I_1       ------------ PROSITE
                 Transcript ------------------------------------------- Transcript
                  1hev A  1 EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD 43
                                    10        20        30        40   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HEV)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (HEVE_HEVBR | P02877)
molecular function
    GO:0008061    chitin binding    Interacting selectively and non-covalently with chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
biological process
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hev)
 
  Sites
(no "Sites" information available for 1hev)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1hev)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Distance Plot
  representative atom: Ca, model 1

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1hev
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HEVE_HEVBR | P02877
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HEVE_HEVBR | P02877
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HEVE_HEVBR | P028771q9b 1t0w 1wkx 4wp4

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1HEV)