Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF UREE
 
Authors :  H. K. Song, S. B. Mulrooney, R. Huber, R. Hausinger
Date :  24 Sep 01  (Deposition) - 28 Nov 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Metallochaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. K. Song, S. B. Mulrooney, R. Huber, R. Hausinger
Crystal Structure Of Klebsiella Aerogenes Uree, A Nickel-Binding Metallochaperone For Urease Activation.
J. Biol. Chem. V. 276 49359 2001
PubMed-ID: 11591723  |  Reference-DOI: 10.1074/JBC.M108619200

(-) Compounds

Molecule 1 - UREE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: RESIDUES 1-143
    Mutation: YES
    Organism Scientific: KLEBSIELLA AEROGENES
    Organism Taxid: 28451

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1GMU)

(-) Sites  (0, 0)

(no "Site" information available for 1GMU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1GMU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1GMU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1GMU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1GMU)

(-) Exons   (0, 0)

(no "Exon" information available for 1GMU)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:138
 aligned with UREE_ENTAE | P18317 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:138
                                    10        20        30        40        50        60        70        80        90       100       110       120       130        
           UREE_ENTAE     1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYHLGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA 138
               SCOP domains d1gmua1 A:1-70 Urease metallochaperone UreE, N-terminal domain        d1gmua2 A:71-138 Urease metallochaperone UreE, C-terminal domain     SCOP domains
               CATH domains 1gmuA02 A:1-71 Urease metallochaperone UreE, N-terminal domain         1gmuA01 A:72-138  [code=3.30.70.790, no name defined]               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee.ee........eeeeehhhhhh..eeeee.....eeeee...........eee......eeeeee.eeeeeeee..hhhhhhhhhhhhhhh....eee..eeeee.hhhhhhhhhh....eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1gmu A   1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA 138
                                    10        20        30        40        50        60        70        80        90       100       110       120       130        


Chain B from PDB  Type:PROTEIN  Length:138
 aligned with UREE_ENTAE | P18317 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:138
                                    10        20        30        40        50        60        70        80        90       100       110       120       130        
           UREE_ENTAE     1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYHLGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA 138
               SCOP domains d1gmub1 B:1-70 Urease metallochaperone UreE, N-terminal domain        d1gmub2 B:71-138 Urease metallochaperone UreE, C-terminal domain     SCOP domains
               CATH domains 1gmuB02 B:1-71 Urease metallochaperone UreE, N-terminal domain         1gmuB01 B:72-138  [code=3.30.70.790, no name defined]               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee.ee........eeeeehhhhhh..eeeee.....eeeee...........eee.......eeeee.eeeeeeee..hhhhhhhhhhhhhhh....eee..eeeee.hhhhhhhhhh....eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1gmu B   1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA 138
                                    10        20        30        40        50        60        70        80        90       100       110       120       130        


Chain C from PDB  Type:PROTEIN  Length:140
 aligned with UREE_ENTAE | P18317 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
           UREE_ENTAE     1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYHLGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGAYA 140
               SCOP domains d1gmuc1 C:1-70 Urease metallochaperone UreE, N-terminal domain        d1gmuc2 C:71-140 Urease metallochaperone UreE, C-terminal domain       SCOP domains
               CATH domains 1gmuC02 C:1-71 Urease metallochaperone UreE, N-terminal domain         1gmuC01 C:72-138  [code=3.30.70.790, no name defined]              -- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.ee........eeeeehhhhhh..eeeee.....eeeee...........eee......eeeeee.eeeeeeee..hhhhhhhhhhhhhhh....eee..eeeee.hhhhhhhhhh....eeeeeee...hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1gmu C   1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGAYA 140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140


Chain D from PDB  Type:PROTEIN  Length:138
 aligned with UREE_ENTAE | P18317 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:138
                                    10        20        30        40        50        60        70        80        90       100       110       120       130        
           UREE_ENTAE     1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYHLGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA 138
               SCOP domains d1gmud1 D:1-70 Urease metallochaperone UreE, N-terminal domain        d1gmud2 D:71-138 Urease metallochaperone UreE, C-terminal domain     SCOP domains
               CATH domains 1gmuD02 D:1-71 Urease metallochaperone UreE, N-terminal domain         1gmuD01 D:72-138  [code=3.30.70.790, no name defined]               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee.ee........eeeeehhhhhh..eeeee.....eeeee...........eee......eeeeee.eeeeeeee..hhhhhhhhhhhhhhh....eee..eeeee.hhhhhhhhhh....eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1gmu D   1 MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA 138
                                    10        20        30        40        50        60        70        80        90       100       110       120       130
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1GMU)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (UREE_ENTAE | P18317)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016151    nickel cation binding    Interacting selectively and non-covalently with nickel (Ni) cations.
    GO:0051082    unfolded protein binding    Interacting selectively and non-covalently with an unfolded protein.
biological process
    GO:0018307    enzyme active site formation    The modification of part of an enzyme to form the active site.
    GO:0006461    protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex.
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0019627    urea metabolic process    The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1gmu)
 
  Sites
(no "Sites" information available for 1gmu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1gmu)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1gmu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UREE_ENTAE | P18317
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  UREE_ENTAE | P18317
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UREE_ENTAE | P18317: 1gmv 1gmw

(-) Related Entries Specified in the PDB File

1gmv STRUCTURE OF UREE
1gmw STRUCTURE OF UREE